Property Summary

NCBI Gene PubMed Count 155
PubMed Score 794.79
PubTator Score 459.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (21)

Disease log2 FC p
psoriasis -1.400 1.2e-02
atypical teratoid / rhabdoid tumor 2.600 4.3e-03
primitive neuroectodermal tumor 2.000 4.3e-03
Atopic dermatitis -1.300 3.4e-04
adrenocortical adenoma -1.776 2.7e-05
adrenocortical carcinoma -1.610 3.5e-05
non-small cell lung carcinoma -1.600 3.4e-12
intraductal papillary-mucinous adenoma (... -1.500 1.8e-04
intraductal papillary-mucinous neoplasm ... -1.600 1.8e-03
lung cancer -5.900 1.8e-07
interstitial cystitis -2.100 4.3e-04
lung adenocarcinoma -2.500 3.3e-14
posterior fossa group B ependymoma 1.100 9.1e-03
sonic hedgehog group medulloblastoma 1.300 1.4e-02
aldosterone-producing adenoma -1.459 8.9e-03
Breast cancer -1.700 3.2e-02
invasive ductal carcinoma -3.100 1.4e-04
lung carcinoma -4.000 2.0e-23
breast carcinoma -2.000 6.9e-23
ductal carcinoma in situ -2.600 9.7e-05
pituitary cancer -2.700 1.2e-04

Gene RIF (132)

PMID Text
26977595 GPC3 expression was measured in hepatocellular carcinoma at different stages and correlated with prognosis. CK19+/GPC3+ HCC has the highest risk of intrahepatic metastasis, microvascular invasion, regional lymph node involvement, and distant metastasis.
26764243 In South Korean hepatocellular carcinoma patients, GPC3 expression was more frequent in hepatocellular carcinoma with aggressive features, but it was not an independent prognostic biomarker.
26722522 Glypican 3 expression showed a significant difference between endometrioid endometrial carcinoma and serous endometrial carcinoma, and it was significantly correlated with tumor grade, stage and myometrial invasion
26517809 Data show that notum and glypican-1 and glypican-3 gene expression during colorectal cancer (CRC) development and present evidence to suggest them as potential new biomarkers of CRC pathogenesis.
26502856 In this meta-analysis, GPC3 was found to be acceptable as a serum marker for the diagnosis of hepatocellular carcinoma.
26345955 GPC3 may be a candidate marker for detecting lung squamous cell carcinoma.
26332121 study suggests that GPC3 is involved in HCC cell migration and motility through HS chain-mediated cooperation with the HGF/Met pathway, showing how HS targeting has potential therapeutic implications for liver cancer
26256079 Review: Glypican-3 is a highly specific biomarker for the diagnosis of hepatocellular carcinoma and a promising therapeutic target.
26052074 Identify a GPC3-specific T-cell receptor. Expression of this receptor by T cells allows them to recognize and kill GPC3-positive hepatoma cells.
25967456 Downregulation of glypican-3 expression increases migration, invasion, and tumorigenicity of ovarian cancer.
25896897 potential role of GPC3 in urothelial carcinogenesis warrants further investigation, especially the potential use of Glypican-3 for therapeutic and diagnostic purposes
25862856 OPN, SPINK1, GPC3 and KNPA2 were significantly over-expressed in HCC tissues. These genes may be useful in developing future biomarkers and therapeutic strategies for HCC
25822763 Data indicate that the triple stain of reticulin, glypican-3, and glutamine synthetae is useful in the differentiation of hepatocellular carcinoma, hepatic adenoma, and focal nodular hyperplasia.
25784484 In HCC patients, sGPC3N levels were significantly increased (mean/median, 405.16/236.19 pg mL(-1) ) compared to healthy controls (p < 0.0001), and 60% of HCC cases (69/115) showed sGPC3N levels that were higher than the upper normal limit.
25735325 High expression of glypican-3 is associated hepatoblastoma.
25653284 propose that the structural changes generated by the lack of cleavage determine a change in the sulfation of the HS chains and that these hypersulfated chains mediate the interaction of the mutant GPC3 with Ptc
25619476 GPC3 and E-cadherin expressions are not independent prognostic factors in CRC.
25572615 GPC3 contributes to hepatocellular carcinoma progression and metastasis through impacting epithelial-mesenchymal transition of cancer cells, and the effects of GPC3 are associated with ERK activation.
25542894 This study demonstrated that highly expression of GPC3 could enrich hepatocellular carcinoma -related genes' mRNA expression and positive associate with dysplasia in cirrhotic livers.
25432695 GPC3 expression is an independent prognostic factor for postoperative hepatocellular carcinoma
25366870 the elevated GPC3 expression in the majority of primary and metastatic Wilms tumors, but not in other renal neoplasms, indicates a possible role of GPC3 in Wilms tumor development
25344940 Most cases of hepatoblastoma and yolk sac tumor, and some cases of other tumors were found to express GPC3. On the other hand, GPC3 was physiologically expressed during the fetal and neoinfantile period under 1 year of age.
25270552 GPC3 is associated with the HCC cell biological behavior.
25195714 Data indicate that zinc-fingers and homeoboxes 2 (ZHX2) suppresses glypican 3 (GPC3) transcription by binding with its core promoter.
25168166 Data shows that GPC3 gene expression is downregulated in primary clear cell renal cell carcinoma; its overexpression arrest cells in G1 phase suggesting its role as tumor suppressor in clear cell renal cell carcinoma.
25115442 This study identified heparan sulfate, partly through glypican-3, as a novel binding partner of GEP on the surface of liver cancer cells.
25073799 In the title.
24876756 GPC3 overexpression tends to be associated with a poor prognosis (poor OS or DFS) in hepatocellular carcinoma [meta-analysis]
24841158 Glypican-3 is the only oncofetal antigen that showed comparable high diagnostic accuracy as PIVKA-II in diagnosing HCC among Egyptian patients.
24804215 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24747240 high expression was found for GPC-3 membrane protein in hepatocellular carcinoma
24548704 GPC3 overexpression indicates a poor prognosis for patients with HCC, and it may also have predictive potential for HCC invasion and metastasis.
24521523 in the current study we evaluated the safety, tolerability, and pharmacokinetic (PK) characteristics of GC33 ( a humanized mAb against human glypican-3)in Japanese patients.
24498024 Data suggest that glypican-3 (GPC3)-positive dysplastic nodules (DN) was really a late premalignant lesion of hepatocellular carcinoma (HCC).
24496449 Data demonstrate that GPC3 plays a more direct role in the stimulation of Wnt signaling.
24492943 Glypican-3 (GPC3) is an HSPG that is highly expressed in hepatocellular carcinoma, where it can attract Wnt proteins to the cell surface and promote cell proliferation.
24460300 High Serum glypican-3 level is associated with hepatocellular carcinoma.
24459012 Both the GPC3 and the CTNNB1 mutations contributed to tumorigenesis.
24439425 We show that GPC3, an hepatocellular carcinoma biomarker and Hh mediator, regulates human stellate cell viability by regulating Hh signaling.
24362268 GPC-3 has moderate diagnostic accuracy for HCC.
24236824 It is a tumor marker for diagnosis of hepatocellular carcinoma (HCC).
24225756 GPC3 expression is frequent in squamous cell carcinomas and invasive urothelial carcinomas
24207089 Immunocytochemical staining for GPC3 in cell block material is a highly sensitive and specific method capable of distinguishing HCC from the vast majority of metastatic carcinomas of the liver.
24186850 The usefulness of serum Transforming growth factor-beta1 (TGF-beta1), Glypican-3 (GPC3), and Golgi protein-73 (GP73) mRNAs as early biomarkers in HCC Egyptian patients, was investigated.
24115482 The unique disease-causing mutation likely arose de novo in the mother. It is a deletion-insertion that leads to a frameshift at the p.S349 residue of GPC3 and a premature stop codon after five more amino acids
23743582 GPC3 is comparable to AFP as a serum marker for the diagnosis of HCC, combination of AFP and GPC3 can elevate the sensitivity of diagnosis
23643963 average level of sGPC3 in HCC patients was 99.94+/-267.2ng/ml, which was significantly higher than in patients with chronic hepatitis, liver cirrhosis, non-HCC cancer and healthy controls
23624389 We now report that human primary suture mesenchymal cells coexpress GPC1 and GPC3 on the cell surface and release them into the media
23606591 In order to better delineate the phenotypic spectrum of SGBS caused by GPC3 mutations, and to try to define specific clinical criteria for GPC3 molecular testing, we reviewed the clinical features of all male cases with a GPC3 mutation
23598528 miR-1291 is a biologically relevant regulator of GPC3 expression in hepatoma cells and acts through silencing of the endoplasmic reticulum stress sensor IRE1alpha.
23558072 GPC-3 protein/mRNA overexpression and alpha-fetoprotein levels could be used as markers for the diagnosis of HCC and monitoring its metastasis.
23530909 GPC3 positivity was limited to a small subset of central nervous system neoplasms and may thus serve as a useful positive diagnostic biomarker
23526389 Data suggest that the use of monoclonal antibody (7D11 mAb) might be good for Glypican-3 (GPC3) large-scale applications for clinical diagnosis of hepatocellular carcinoma (HCC).
23471984 Therapeutically targeting glypican-3 via a conformation-specific single-domain antibody in hepatocellular carcinoma.
23348905 Glypican 3 and arginase-1 are the most reliable markers for identifying scirrhous hepatocellular carcinoma.
23327927 We present a novel role for TFPI and GPC3 in regulating hematopoietic stem cell homing as well as retention in the bone marrow.
23192642 High glypican-3 expression is associated with hepatoma.
23114924 results suggest that expression and activation of mitogenic receptors MET and EGFR, combined with potential mitoinhibitory effects of FAS and GPC3, create stimuli in which cell proliferation is limited and transdifferentiation process is enhanced.
23084579 Evaluation of GPC3 immunoexpression may be a useful diagnostic tool to distinguish epithelioid sarcomas from malignant rhabdoid tumors.
23079207 Glypican-3 can be expressed in 14% of carcinomas/neoplasms of the gastrointestinal tract and pancreas.
23060277 study reveals that GPC3 promotes the growth of hepatocellular carcinoma (HCC) by increasing cell proliferation, enhancing metastasis as well as invasion; GPC3 may collaborate with YAP to regulate the HCC development
22865282 In a subgroup of hepatocellular carcinoma, the up-regulation of glypican-3 was associated with a concomitant down-regulation of its repressor miR-1271.
22706665 Elevated levels of c-Myc correlate with the overexpression of GPC3 in human Hepatocellular Carcinoma samples.
22449976 These findings indicate that miR-219-5p exerts tumor-suppressive effects in hepatic carcinogenesis through negative regulation of glypican 3 expression [MiR-219-5p].
22448662 glypican 3 is strongly positive in yolk sac tumors but is not as specific a tumor marker as SALL4 for that tumor type.
22382024 The results suggest that GPC3 regulates cell proliferation by enhancing the resistance to apoptosis through the dysfunction of the Bax/Bcl-2/cytochrome c/caspase-3 signaling pathway and therefore plays a critical role in the tumorigenesis of hepatocellular carcinoma.
22298472 Loss of glypican 3 is associated with metastasis in hepatocellular carcinoma.
22119409 results show that GPC3 is specifically overexpressed in hepatocellular carcinoma tissue and may be regarded as a potential marker for differential diagnostic hepatocellular carcinoma
22026458 GPC3 is a helpful ancillary diagnostic marker for pancreatic solid pseudopapillary neoplasm
21937079 Our data demonstrate that GPC3 is expressed in a subset of undifferentiated embryonal sarcoma and mesenchymal hamartoma of the liver.
21919070 Results show there was no correlation between GPC3 levels and prognostic parameters in hepatocellular carcinoma. GPC3 is not a useful diagnostic and prognostic marker for HCC.
21847365 molecular targeting of GPC3 at the translational level offers an effective option for the clinical management of GPC3-positive HCC patients.
21822558 In a cohort analysis of disease-free survival, aberrant tumor expression of osteopontin and GPC3 were prognostic factors for recurrence and poor outcome.
21655958 GPC3 might be a valuable marker closely related with prognosis and post-operative metastasis/recurrence in hepatocellular cancer patients.
21617840 Results suggest that GPC3 contributes to the proliferation and metastasis of hepatocellular carcinoma and that it may be a potential molecular target for HCC treatment.
21586223 GPC-3 was highly expressed in hepatocellular carcinoma, moderately expressed in surrounding tissues and not expressed in distal tissues.
21556932 High GPC3 mRNA expression is associated with lung squamous cell carcinoma.
21493758 This study highlights expression of glypican-3 in rhabdomyosarcomas but not other soft tissue sarcomas.
21438004 The sensitivity of hepatocellular carcinoma diagnosis can be improved by combined detection of AFP and GPC3 mRNA expressions.
21429352 GPC3 is highly expressed in advanced hepatocellular carcinoma, moderately expressed in well-differentiated HCC, and not expressed at all in dysplastic or cirrhotic nodules, focal nodular hyperplasia and hepatocellular adenoma.
21410073 overview of Gpc-3 expression in hepatocellular carcinoma and its expression of relationship between clinicopathological features of hepatocellular carcinoma, analysis expression of Gpc-3 in liver cell adenoma, heterosexual hyperplasia and hepatitis C
21371925 The results confirm the high expression of GPC3 in hepatocellular carcinoma and suggest its potential diagnostic value as a clinical marker for this disease.
21303616 Study confirm the differential GPC3 expression in two human HCC cells, Hep G2 (high) and HLF (negligible).
21187490 Expression of GPC3 was found to be markedly elevated in HCCs. In the human HCC cell lines, GPC3 expression was consistently observed, and was mainly located in the cell membrane and cytoplasm.
20964802 Circumferential membranous GPC3 immunoreactivity in hepatocellular carcionoma indicates poorer prognosis particularly in patients with hepatitis c virus infection.
20950395 loss of the functional GPC3 protein by 43% is closed to the threshold to develop the Simpson-Golabi-Behmel syndrome phenotype
20868507 GPC3 may be a useful adjunct immunohistochemical marker in differentiating placental site trophoblastic tumor from non-trophoblastic tumors.
20845507 Data show that glypican 3 is a sensitive and specific serum marker for diagnosis of early hepatocellular carcinoma.
20803547 GPC3 plays a role in glucose transport by interacting with GLUT1.
20725905 Mechanism mediating the oncogenic function of SULF2 in human hepatoma that includes GPC3-mediated activation of Wnt signaling.
20701957 Data demonstrate for the first time the presence of elevated levels of GPC3 protein associated with cell growth inhibition in ovarian clear cell carcinoma.
20653060 GPC3, in conjunction with MMPs and growth signaling molecules, might play an important role in the progression of hepatocellular carcinoma.
20546340 YST can display a variety of growth patterns that can be confused with other germ cell tumour components. GPC3 detects all growth patterns tested and has a higher sensitivity for detecting YST
19838081 glypican-3 is involved in the recruitment of M2-polarized tumor-associated macrophages in hepatocellular carcinoma
19816934 Data show that mutated GPC3 lacking the GPI anchoring domain (sGPC3) significantly inhibited the in vivo growth, blocked Wnt signaling and Erk1/2 and Akt phosphorylation in tumors.
19793164 Serum GPC3 is highly specific for detecting hepatocellular carcinoma (HCC). The combined use of serum GPC3 and alpha-fetoprotein may better differentiate HCC from benign liver disorders, as well as from other liver cancers.
19574883 SALL4 is a more sensitive marker than PLAP, AFP, or glypican-3 for extragonadal yolk sac tumors.
19513517 Detection of glypican-3-specific CTLs in chronic hepatitis and liver cirrhosis.
19496787 GPC3 expression is correlated with poor prognosis in hepatocellular carcinoma.
19405109 Our data supports the potentially significant diagnostic utility of GPC-3 in fine-needle aspiration biopsies in differentiating primary malignant from benign and preneoplastic liver lesions, and metastatic carcinomas.
19329941 overexpression of glypican-3 may be related to the development and aggressive behavior of ovarian clear cell adenocarcinoma.
19231003 A reliable marker for the detection of hepatocellular carcinoma in liver biopsies.
19215053 A patient with the Simpson-Golabi-Behmel syndrome displays a loss-of-function point mutation in GPC3 that inhibits the attachment of this proteoglycan to the cell surface.
19141032 Report the expression profile of glypican-3 and its relation to macrophage population in human hepatocellular carcinoma.
18976006 GPC3 expression in HCCs did not correlate with the size, differentiation, or stage of the tumors; the presence or absence of cirrhotic background; or the underlying etiologies
18813403 The effector cells stimulated with DCs that were transfected with pEF-hGPC3 plasmid could effectively lyse GPC3 expressing HepG2 cells.
18813128 GPC3 is frequently expressed in noncutaneous small cell neuroendocrine carcinoma of various origins, in particular in Merkel cell carcinoma, which, in combination with CK20
18785116 Report expression pattern of glypican-3 (GPC3) during human embryonic and fetal development.
18511877 GPC3 is expressed at an early stage, suggesting that GPC3 expression in thyroid cancer is an early event in developing papillary carcinoma.
18469798 Glypican-3 expression is a potential candidate marker for early detection of lung squamous cell carcinoma.
18462363 Glypican-3 appears to be a reliable markers for ovarian germ-cell tumors.
18413366 GPC3 confers oncogenecity through the interaction between IGF-II and its receptor, and the subsequent activation of the IGF-signaling pathway.
18277882 GPC3 seems to be a promising diagnostic marker for differentiating yolk sac tumors from ovarian clear cell carcinomas.
18264086 staining for glypican-3 is a highly sensitive and specific method capable of distinguishing HCC from other benign and malignant hepatic lesions
17949790 GPC3 may play a role in the tumorigenesis of hepatoblastoma.
17949778 GPC is detected by immunostaining in necroinflammatory lesions, therefore its use as a cancer stain should be interpreted cautiously.
17603795 No hot spot for GPC3 mutations or deletions in the patients with Simpson-Golabi-Behmel syndrome.
17581422 Data show that GPC3 is observed in a significant fraction of primary and corresponding recurrent ovarian carcinomas.
17549790 Both the glycosylated and unglycosylated forms of GPC3 interact with CD26 peptidase, resulting in inhibition of the enzyme.
17087938 Molecular data based on gene transcriptional profiles of a 3-gene set (GPC3, LYVE1, and survivin) allow a reliable diagnosis of early hepatocellular carcinoma.
16682817 Data show that forced expression of glypican-3 (GPC3) reduced the growth of hepatocellular carcinoma cells, and that FGF2-mediated cell proliferation was inhibited by GPC3.
16675560 GPC3 peptides may be applicable to cancer immunotherapy for a large number of hepatocellular carcinoma patients
16299239 GPC3 and SPARC in combination diagnosed 47 of 75 (66.2%) melanoma patients at an early stage (0-II).
16227623 glypican-3-induced stimulation of hepatocellular carcinoma growth does not require convertase processing
15475451 GPC3 is apparently a novel tumor marker useful for the diagnosis of melanoma, especially in early stages of the disorder.
15083193 Although promoter methylation is likely to affect expression status of the GPC3 gene, study results suggest that deregulation of GPC3 transcriptional expression seen in neuroblastoma and Wilm's tumor involves other regulatory levels.
14661052 involvement in the cellular protection against mitoxantrone in the atypical multidrug-resistant gastric carcinoma cell line EPG85-257RNOV
12824919 Overexpressed in human hepatocellular carcinoma, hence a good molecular marker.
12816733 These findings suggest that GPC3 is a candidate lung tumor suppressor gene whose expression may be regulated by exposure to cigarette smoke and functions to modulate cellular response to exogenous damage.
12478660 GPC3 is upregulated in hepatocellular carcinoma and has a role in liver carcinogenesis
12085187 Mutations in GPC3 is associated with Wilm's tumor
11893651 Candidate lung tumor suppressor gene which may be regulated by tobacco exposure.

AA Sequence

MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGP      1 - 70
TCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQ     71 - 140
AFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGN    141 - 210
FPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNV    211 - 280
VMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCA    281 - 350
HSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDT    351 - 420
LCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDE    421 - 490
EGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS    491 - 560
PLKLLTSMAISVVCFFFLVH                                                      561 - 580
//

Text Mined References (154)

PMID Year Title
26977595 2016 CK19 and Glypican 3 Expression Profiling in the Prognostic Indication for Patients with HCC after Surgical Resection.
26764243 2016 Expression profile and prognostic value of glypican-3 in post-operative South Korean hepatocellular carcinoma patients.
26722522 2015 Immunohistochemical expression of glypican 3 in endometrial carcinoma and correlation with prognostic parameters.
26517809 2015 Novel insights into Notum and glypicans regulation in colorectal cancer.
26502856 2015 Diagnosis accuracy of serum Glypican-3 level in patients with hepatocellular carcinoma and liver cirrhosis: a meta-analysis.
26345955 2015 Differential expression of glypican-3 (GPC3) in lung squamous cell carcinoma and lung adenocarcinoma and its clinical significance.
26332121 2015 Human Monoclonal Antibody Targeting the Heparan Sulfate Chains of Glypican-3 Inhibits HGF-Mediated Migration and Motility of Hepatocellular Carcinoma Cells.
26256079 2015 Glypican-3 is a biomarker and a therapeutic target of hepatocellular carcinoma.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26052074 2015 T Cells Engineered to Express a T-Cell Receptor Specific for Glypican-3 to Recognize and Kill Hepatoma Cells In Vitro and in Mice.
25967456 2015 Downregulation of glypican-3 expression increases migration, invasion, and tumorigenicity of human ovarian cancer cells.
25896897 2015 Expression of Glypican 3 in low and high grade urothelial carcinomas.
25862856 2015 Gene expression analysis for evaluation of potential biomarkers in hepatocellular carcinoma.
25822763 2015 A triple stain of reticulin, glypican-3, and glutamine synthetase: a useful aid in the diagnosis of liver lesions.
25784484 2015 High preoperative levels of serum glypican-3 containing N-terminal subunit are associated with poor prognosis in patients with hepatocellular carcinoma after partial hepatectomy.
25735325 2015 Expression of glypican-3 is highly associated with pediatric hepatoblastoma: a systemic analysis.
25653284 2015 Processing by convertases is required for glypican-3-induced inhibition of Hedgehog signaling.
25619476 2015 Relation of glypican-3 and E-cadherin expressions to clinicopathological features and prognosis of mucinous and non-mucinous colorectal adenocarcinoma.
25572615 2015 Glypican-3 promotes epithelial-mesenchymal transition of hepatocellular carcinoma cells through ERK signaling pathway.
25542894 2015 Expression of glypican 3 enriches hepatocellular carcinoma development-related genes and associates with carcinogenesis in cirrhotic livers.
25432695 2015 Reevaluation of glypican-3 as a prognostic marker in HCC using X-tile software.
25366870 2015 Glypican 3 overexpression in primary and metastatic Wilms tumors.
25344940 2015 Glypican 3 expression in pediatric malignant solid tumors.
25270552 2014 Silencing of the glypican-3 gene affects the biological behavior of human hepatocellular carcinoma cells.
25195714 2014 Reduced nucleic ZHX2 involves in oncogenic activation of glypican 3 in human hepatocellular carcinoma.
25168166 2014 GPC3 reduces cell proliferation in renal carcinoma cell lines.
25115442 2014 Granulin-epithelin precursor interacts with heparan sulfate on liver cancer cells.
25073799 2014 Paternal germline mosaicism for a GPC3 deletion in X-linked Simpson-Golabi-Behmel syndrome.
24876756 2014 Prognostic and clinicopathological significance of glypican-3 overexpression in hepatocellular carcinoma: a meta-analysis.
24841158 2014 Comparing prothrombin induced by vitamin K absence-II (PIVKA-II) with the oncofetal proteins glypican-3, Alpha feto protein and carcinoembryonic antigen in diagnosing hepatocellular carcinoma among Egyptian patients.
24804215 2014 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24747240 2014 Differential expression of anterior gradient protein 3 in intrahepatic cholangiocarcinoma and hepatocellular carcinoma.
24548704 2014 Prognostic significance of glypican-3 in hepatocellular carcinoma: a meta-analysis.
24521523 2014 Japanese phase I study of GC33, a humanized antibody against glypican-3 for advanced hepatocellular carcinoma.
24498024 2014 Dysplastic nodules with glypican-3 positive immunostaining: a risk for early hepatocellular carcinoma.
24496449 2014 Glypican-3 binds to Frizzled and plays a direct role in the stimulation of canonical Wnt signaling.
24492943 2014 Inactivation of Wnt signaling by a human antibody that recognizes the heparan sulfate chains of glypican-3 for liver cancer therapy.
24460300 2013 Can Glypican3 be diagnostic for early hepatocellular carcinoma among Egyptian patients?
24459012 2014 Somatic CTNNB1 mutation in hepatoblastoma from a patient with Simpson-Golabi-Behmel syndrome and germline GPC3 mutation.
24439425 2014 The glypican 3 hepatocellular carcinoma marker regulates human hepatic stellate cells via Hedgehog signaling.
24362268 2014 Diagnostic accuracy of serum glypican-3 for hepatocellular carcinoma: a systematic review and meta-analysis.
24236824 2014 Golgi protein 73, not Glypican-3, may be a tumor marker complementary to ?-Fetoprotein for hepatocellular carcinoma diagnosis.
24225756 2013 Immunohistochemistry for the novel markers glypican 3, PAX8, and p40 (?Np63) in squamous cell and urothelial carcinoma.
24207089 2013 Role of glypican-3 immunocytochemistry in differentiating hepatocellular carcinoma from metastatic carcinoma of the liver utilizing fine needle aspiration cytology.
24186850 2013 Evaluation of circulating Transforming growth factor-beta1, Glypican-3 and Golgi protein-73 mRNAs expression as predictive markers for hepatocellular carcinoma in Egyptian patients.
24115482 2013 A patient with a unique frameshift mutation in GPC3, causing Simpson-Golabi-Behmel syndrome, presenting with craniosynostosis, penoscrotal hypospadias, and a large prostatic utricle.
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
23743582 2013 A comparison of glypican-3 with alpha-fetoprotein as a serum marker for hepatocellular carcinoma: a meta-analysis.
23643963 2013 Reevaluation of glypican-3 as a serological marker for hepatocellular carcinoma.
23624389 2013 Regulation of bone morphogenetic protein signalling and cranial osteogenesis by Gpc1 and Gpc3.
23606591 2013 Phenotypic spectrum of Simpson-Golabi-Behmel syndrome in a series of 42 cases with a mutation in GPC3 and review of the literature.
23598528 2013 MicroRNA-1291-mediated silencing of IRE1? enhances Glypican-3 expression.
23558072 2013 Values of circulating GPC-3 mRNA and alpha-fetoprotein in detecting patients with hepatocellular carcinoma.
23530909 Immunohistochemical expression of glypican-3 in pediatric tumors: an analysis of 414 cases.
23526389 2013 Clinical application of specific antibody against glypican-3 for hepatocellular carcinoma diagnosis.
23471984 2013 Therapeutically targeting glypican-3 via a conformation-specific single-domain antibody in hepatocellular carcinoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23348905 2013 Immunohistochemical pitfalls and the importance of glypican 3 and arginase in the diagnosis of scirrhous hepatocellular carcinoma.
23327927 2013 Glypican-3-mediated inhibition of CD26 by TFPI: a novel mechanism in hematopoietic stem cell homing and maintenance.
23192642 2013 Targeted glypican-3 gene transcription inhibited the proliferation of human hepatoma cells by specific short hairpin RNA.
23114924 2013 Expression of hepatocyte epidermal growth factor receptor, FAS and glypican 3 in EpCAM-positive regenerative clusters of hepatocytes, cholangiocytes, and progenitor cells in human liver failure.
23084579 2013 Glypican 3 expression in tumors with loss of SMARCB1/INI1 protein expression.
23079207 2013 Glypican-3 expression in gastrointestinal and pancreatic epithelial neoplasms.
23060277 2013 Knockdown of GPC3 inhibits the proliferation of Huh7 hepatocellular carcinoma cells through down-regulation of YAP.
22865282 2013 A functional screening identifies five microRNAs controlling glypican-3: role of miR-1271 down-regulation in hepatocellular carcinoma.
22706665 2012 Oncogenic activation of glypican-3 by c-Myc in human hepatocellular carcinoma.
22449976 2012 MiR-219-5p inhibits hepatocellular carcinoma cell proliferation by targeting glypican-3.
22448662 2012 Diagnostic utility of CD117, CD133, SALL4, OCT4, TCL1 and glypican-3 in malignant germ cell tumors of the ovary.
22382024 2012 Silencing glypican-3 expression induces apoptosis in human hepatocellular carcinoma cells.
22298472 2012 Arginase-1: a novel immunohistochemical marker of hepatocellular differentiation in fine needle aspiration cytology.
22119409 2012 Glypican-3 as a potential differential diagnosis marker for hepatocellular carcinoma: a tissue microarray-based study.
22026458 2011 Glypican-3 is a marker for solid pseudopapillary neoplasm of the pancreas.
21937079 2012 Expression of glypican-3 in undifferentiated embryonal sarcoma and mesenchymal hamartoma of the liver.
21919070 2011 Diagnostic and prognostic role of serum glypican 3 in patients with hepatocellular carcinoma.
21847365 2011 Suppression of glypican 3 inhibits growth of hepatocellular carcinoma cells through up-regulation of TGF-?2.
21822558 2012 Recurrence and poor prognosis following resection of small hepatitis B-related hepatocellular carcinoma lesions are associated with aberrant tumor expression profiles of glypican 3 and osteopontin.
21655958 2012 Glypican-3, a novel prognostic marker of hepatocellular cancer, is related with postoperative metastasis and recurrence in hepatocellular cancer patients.
21617840 2011 Inhibition of glypican-3 expression via RNA interference influences the growth and invasive ability of the MHCC97-H human hepatocellular carcinoma cell line.
21586223 2011 [Expression features of glypican-3 and its diagnostic and differential values in hepatocellular carcinoma].
21556932 2012 Expression of GPC3 protein and its significance in lung squamous cell carcinoma.
21493758 2011 Glypican-3 is expressed in rhabdomyosarcomas but not adult spindle cell and pleomorphic sarcomas.
21438004 2011 Detection of ?-fetoprotein and glypican-3 mRNAs in the peripheral blood of hepatocellular carcinoma patients by using multiple FQ-RT-PCR.
21429352 2011 [Expression and clinicopathologic significance of GPC3 and other antibodies in well-differentiated hepatocellular carcinoma].
21410073 Gpc-3 is a notable diagnostic, prognostic and a latent targeted therapy marker in hepatocellular carcinoma.
21371925 2011 Expression and clinicopathologic significance of glypican 3 in hepatocellular carcinoma.
21303616 2011 Glypican-3 targeting of liver cancer cells using multifunctional nanoparticles.
21269460 2011 Initial characterization of the human central proteome.
21187490 2010 Up-regulation of glypican-3 in human hepatocellular carcinoma.
20964802 2011 Prognostic significance of circumferential cell surface immunoreactivity of glypican-3 in hepatocellular carcinoma.
20950395 2011 Familial Simpson-Golabi-Behmel syndrome: studies of X-chromosome inactivation and clinical phenotypes in two female individuals with GPC3 mutations.
20868507 2010 Expression of glypican 3 in placental site trophoblastic tumor.
20845507 2010 Diagnostic value of glypican-3 in serum and liver for primary hepatocellular carcinoma.
20803547 2010 Glypican 3 binds to GLUT1 and decreases glucose transport activity in hepatocellular carcinoma cells.
20725905 2010 The oncogenic effect of sulfatase 2 in human hepatocellular carcinoma is mediated in part by glypican 3-dependent Wnt activation.
20701957 2010 Growth-suppressing function of glypican-3 (GPC3) via insulin like growth factor II (IGF-II) signaling pathway in ovarian clear cell carcinoma cells.
20653060 2010 Association of glypican-3 expression with growth signaling molecules in hepatocellular carcinoma.
20546340 2010 Glypican 3 has a higher sensitivity than alpha-fetoprotein for testicular and ovarian yolk sac tumour: immunohistochemical investigation with analysis of histological growth patterns.
19838081 2009 Involvement of glypican-3 in the recruitment of M2-polarized tumor-associated macrophages in hepatocellular carcinoma.
19816934 2010 Soluble glypican 3 inhibits the growth of hepatocellular carcinoma in vitro and in vivo.
19793164 2010 Diagnostic role of serum glypican-3 in differentiating hepatocellular carcinoma from non-malignant chronic liver disease and other liver cancers.
19574883 2009 Diagnostic utility of SALL4 in extragonadal yolk sac tumors: an immunohistochemical study of 59 cases with comparison to placental-like alkaline phosphatase, alpha-fetoprotein, and glypican-3.
19513517 2009 Detection of glypican-3-specific CTLs in chronic hepatitis and liver cirrhosis.
19496787 2009 Glypican-3 expression is correlated with poor prognosis in hepatocellular carcinoma.
19405109 2009 Utility of glypican-3 and survivin in differentiating hepatocellular carcinoma from benign and preneoplastic hepatic lesions and metastatic carcinomas in liver fine-needle aspiration biopsies.
19329941 2009 Glypican-3 expression in clear cell adenocarcinoma of the ovary.
19243386 2009 Glypican 3-expressing gastric carcinoma: distinct subgroup unifying hepatoid, clear-cell, and alpha-fetoprotein-producing gastric carcinomas.
19231003 2009 The application of markers (HSP70 GPC3 and GS) in liver biopsies is useful for detection of hepatocellular carcinoma.
19215053 2009 A patient with the Simpson-Golabi-Behmel syndrome displays a loss-of-function point mutation in GPC3 that inhibits the attachment of this proteoglycan to the cell surface.
19141032 2009 The expression profile of glypican-3 and its relation to macrophage population in human hepatocellular carcinoma.
18976006 2008 Glypican-3 as a useful diagnostic marker that distinguishes hepatocellular carcinoma from benign hepatocellular mass lesions.
18813403 2008 Glypican3 in genetically modified human monocyte-derived dendritic cells induced specific cytotoxity against glypican3 overexpressing human hepatocellular carcinoma cells in vitro.
18813128 2009 Frequent expression of glypican-3 in Merkel cell carcinoma: an immunohistochemical study of 55 cases.
18785116 2008 Expression pattern of glypican-3 (GPC3) during human embryonic and fetal development.
18511877 2007 Immunohistochemical study of glypican 3 in thyroid cancer.
18469798 2008 Glypican-3 is overexpressed in lung squamous cell carcinoma, but not in adenocarcinoma.
18462363 2008 Glypican-3 immunohistochemistry in the ovary.
18413366 2008 Glypican-3-mediated oncogenesis involves the Insulin-like growth factor-signaling pathway.
18277882 2008 Oncofetal protein glypican-3 distinguishes yolk sac tumor from clear cell carcinoma of the ovary.
18264086 2008 Utility of glypican-3 in differentiating hepatocellular carcinoma from other primary and metastatic lesions in FNA of the liver: an immunocytochemical study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17949790 2008 Expression of glypican 3 in hepatoblastoma: an immunohistochemical study of 65 cases.
17949778 2008 Glypican-3 expression in benign liver tissue with active hepatitis C: implications for the diagnosis of hepatocellular carcinoma.
17603795 2007 GPC3 mutations in seven patients with Simpson-Golabi-Behmel syndrome.
17581422 2007 Glypican-3 expression in primary and recurrent ovarian carcinomas.
17549790 2007 The Simpson-Golabi-Behmel syndrome causative glypican-3, binds to and inhibits the dipeptidyl peptidase activity of CD26.
17087938 2006 A molecular signature to discriminate dysplastic nodules from early hepatocellular carcinoma in HCV cirrhosis.
16682817 2006 Cellular changes resulting from forced expression of glypican-3 in hepatocellular carcinoma cells.
16675560 2006 Identification of HLA-A2- or HLA-A24-restricted CTL epitopes possibly useful for glypican-3-specific immunotherapy of hepatocellular carcinoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16299239 2005 Highly sensitive detection of melanoma at an early stage based on the increased serum secreted protein acidic and rich in cysteine and glypican-3 levels.
16227623 2005 Processing by convertases is not required for glypican-3-induced stimulation of hepatocellular carcinoma growth.
15772651 2005 The DNA sequence of the human X chromosome.
15475451 2004 Identification of glypican-3 as a novel tumor marker for melanoma.
15083193 2004 Methylation analysis of the glypican 3 gene in embryonal tumours.
14661052 2004 Glypican-3 is involved in cellular protection against mitoxantrone in gastric carcinoma cells.
12824919 2003 Glypican-3 is overexpressed in human hepatocellular carcinoma.
12816733 2003 The heparan sulfate proteoglycan GPC3 is a potential lung tumor suppressor.
12478660 2003 Glypican-3, overexpressed in hepatocellular carcinoma, modulates FGF2 and BMP-7 signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11320054 2001 Glypicans in growth control and cancer.
11193214 2001 Glypican-3 (GPC3) expression in human placenta: localization to the differentiated syncytiotrophoblast.
10814714 2000 Mutational analysis of the GPC3/GPC4 glypican gene cluster on Xq26 in patients with Simpson-Golabi-Behmel syndrome: identification of loss-of-function mutations in the GPC3 gene.
9950367 1999 A small interstitial deletion in the GPC3 gene causes Simpson-Golabi-Behmel syndrome in a Dutch-Canadian family.
9931407 1998 Glypican 3 and glypican 4 are juxtaposed in Xq26.1.
9853964 1998 Gpc3 expression correlates with the phenotype of the Simpson-Golabi-Behmel syndrome.
9787072 1998 GPC4, the gene for human K-glypican, flanks GPC3 on xq26: deletion of the GPC3-GPC4 gene cluster in one family with Simpson-Golabi-Behmel syndrome.
9630066 1998 Overgrowth syndromes and genomic imprinting: from mouse to man.
9371521 1997 Cloning and expression of a developmentally regulated transcript MXR7 in hepatocellular carcinoma: biological significance and temporospatial distribution.
9339360 1997 Analysis of exon/intron structure and 400 kb of genomic sequence surrounding the 5'-promoter and 3'-terminal ends of the human glypican 3 (GPC3) gene.
9133586 1997 Cloning and characterization of human cDNAs encoding a protein with high homology to rat intestinal development protein OCI-5.
9021160 1997 Mapping of the Simpson-Golabi-Behmel overgrowth syndrome gene (GPC3) to chromosome X in human and rat by fluorescence in situ hybridization.
8589713 1996 Mutations in GPC3, a glypican gene, cause the Simpson-Golabi-Behmel overgrowth syndrome.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7909248 1994 Mapping of Simpson-Golabi-Behmel syndrome to Xq25-q27.