Property Summary

NCBI Gene PubMed Count 43
PubMed Score 224.62
PubTator Score 104.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 1.6e-02
psoriasis 1.100 2.3e-03
osteosarcoma 3.179 4.6e-04
glioblastoma 1.300 1.9e-03
medulloblastoma, large-cell -1.700 1.2e-02
non-small cell lung cancer 1.965 4.3e-13
intraductal papillary-mucinous adenoma (... -1.400 3.8e-05
pediatric high grade glioma 1.300 1.3e-03
group 4 medulloblastoma -1.100 1.2e-03
ovarian cancer 1.600 7.4e-04

Gene RIF (25)

PMID Text
26517809 Data show that notum and glypican-1 and glypican-3 gene expression during colorectal cancer (CRC) development and present evidence to suggest them as potential new biomarkers of CRC pathogenesis.
26203194 The C terminus is shown to be highly flexible in solution, but it orients the core protein transverse to the membrane, directing a surface evolutionarily conserved in Gpc1 orthologs toward the membrane, where it may interact with signaling molecules
26106858 GPC1(+) crExos were detected in the serum of patients with pancreatic cancer with absolute specificity and sensitivity, distinguishing healthy subjects and patients with a benign pancreatic disease in patients with early-and late-stage pancreatic cancer.
25505242 The interaction of HIV-1 CA with human cellular glypican 1 protein (GPC1) is identified by yeast two-hybrid screen
25046223 differences in expression among different subtypes of ameloblastomas
24463821 GPC1 and FGFR1 are targets for regulation of their gene expression by miR-149.
23736812 DNA from 4 HPV positive and 4 HPV negative fresh frozen primary HNSCC were subject to comprehensive genome-wide methylation profiling.Pathway analysis of 1168 methylated genes showed 8 signal transduction pathways (GPC1) of which 62% are hypermethylated.
23624389 We now report that human primary suture mesenchymal cells coexpress GPC1 and GPC3 on the cell surface and release them into the media
22351761 Crystal structure of N-glycosylated human glypican-1 core protein shows the structure of two loops evolutionarily conserved in vertebrate glypican-1
21932778 Mutagenesis and enzymatic cleavage indicated that the potential N-glycosylation sites are invariably occupied.
21265098 High glucose can decrease the expression of core protein Sydecan-1 and Glypican-1 in cultured human renal glomerular endothelial cells.
19479373 The N-unsubstituted glucosamine residues are formed during biosynthesis of glypican-1 and the content increased upon inhibition of polyamine synthesis.
19166823 study concludes that Abeta can modulate the cellular expression of agrin and glypican-1, which may contribute to the accumulation of these heparan sulfate proteoglycans in Alzheimer's disease lesions
19023125 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18634034 Observational study of gene-disease association. (HuGE Navigator)
18536657 Glypican-3 can be especially useful in the identification of poorly differentiated hepatocellular carcinoma.
18064304 cancer cell- and host-derived GPC1 are crucial for full mitogenic, angiogenic, and metastatic potential of cancer cells
17016645 Enhanced GPC1 expression correlates with BMP and activin receptors in pancreatic cancer.
16723715 altered HSPGs contribute to enhanced signaling of FGF-2 via FGFR1c in gliomas with glypican-1 playing a significant role in this mitogenic pathway
15547662 glypican 1 (GPC1) is deleted in both reported patients suffering from Albright hereditary osteodystrophy-like (AHO-like) syndrome
15297422 syndecan-1 and glypican-1 have roles in progression of ovarian cancer
15249209 glypican-1 is required for efficient TGF-beta1 signaling in pancreatic cancer cells
12972423 inhibition of Gpc-1 expression abrogates spermine uptake and intracellular delivery; ascorbate released NO, which degraded heparan sulfate side chains and liberated the bound spermine
12084716 S-nitrosylation and Copper-dependent autocleavage of glypican 1
11968010 Augmented synthesis and differential localization of heparan sulfate proteoglycans in Duchenne muscular dystrophy.

AA Sequence

MELRARGWWLLCAAAALVACARGDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCT      1 - 70
SEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARA     71 - 140
FRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAEALRPFGEAPRELR    141 - 210
LRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCL    211 - 280
ANQADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNP    281 - 350
QGPGPEEKRRRGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMA    351 - 420
RGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQDASDDGSGSGS    421 - 490
GDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTFLLPLLLFLALTVARPRWR      491 - 558
//

Text Mined References (50)

PMID Year Title
26517809 2015 Novel insights into Notum and glypicans regulation in colorectal cancer.
26203194 2015 Structural Aspects of N-Glycosylations and the C-terminal Region in Human Glypican-1.
26106858 2015 Glypican-1 identifies cancer exosomes and detects early pancreatic cancer.
25046223 2015 Differential expression of glypican-1 in ameloblastoma variants.
24463821 2014 Autoregulation of glypican-1 by intronic microRNA-149 fine tunes the angiogenic response to FGF2 in human endothelial cells.
23736812 2013 Epigenetic modulation of signal transduction pathways in HPV-associated HNSCC.
23624389 2013 Regulation of bone morphogenetic protein signalling and cranial osteogenesis by Gpc1 and Gpc3.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22351761 2012 Crystal structure of N-glycosylated human glypican-1 core protein: structure of two loops evolutionarily conserved in vertebrate glypican-1.
21932778 2011 The structural role of N-linked glycans on human glypican-1.
21642435 2011 Suppression of amyloid beta A11 antibody immunoreactivity by vitamin C: possible role of heparan sulfate oligosaccharides derived from glypican-1 by ascorbate-induced, nitric oxide (NO)-catalyzed degradation.
21265098 2010 [Effect of high concentration of glucose on thickness of glycocalyx and expression of syndecan-1 and glypican-1 in cultured human renal glomerular endothelial cells].
19936054 2009 Glypican-1 mediates both prion protein lipid raft association and disease isoform formation.
19775117 2009 Chemical and thermal unfolding of glypican-1: protective effect of heparan sulfate against heat-induced irreversible aggregation.
19479373 2009 S-Nitrosylation of secreted recombinant human glypican-1.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19166823 2009 Amyloid beta induces cellular relocalization and production of agrin and glypican-1.
19023125 2009 A genome-wide association study of schizophrenia using brain activation as a quantitative phenotype.
18634034 2009 Common genetic variants in pre-microRNAs were associated with increased risk of breast cancer in Chinese women.
18536657 2008 Utility and limitations of glypican-3 expression for the diagnosis of hepatocellular carcinoma at both ends of the differentiation spectrum.
18064304 2008 Glypican-1 modulates the angiogenic and metastatic potential of human and mouse cancer cells.
17016645 2006 Correlation of glypican-1 expression with TGF-beta, BMP, and activin receptors in pancreatic ductal adenocarcinoma.
16971378 2006 Constitutive and vitamin C-induced, NO-catalyzed release of heparan sulfate from recycling glypican-1 in late endosomes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16723715 2006 Glypican-1 is frequently overexpressed in human gliomas and enhances FGF-2 signaling in glioma cells.
16645004 2006 Defective nitric oxide-dependent, deaminative cleavage of glypican-1 heparan sulfate in Niemann-Pick C1 fibroblasts.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15547662 2004 Two further AHO-like syndrome patients with deletion of glypican 1 gene region in 2q37.2-q37.3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15297422 2004 Distribution and clinical significance of heparan sulfate proteoglycans in ovarian cancer.
15249209 2004 Glypican-1 antisense transfection modulates TGF-beta-dependent signaling in Colo-357 pancreatic cancer cells.
15084524 2004 Glypican-1 as an Abeta binding HSPG in the human brain: its localization in DIG domains and possible roles in the pathogenesis of Alzheimer's disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972423 2003 Glypican-1 is a vehicle for polyamine uptake in mammalian cells: a pivital role for nitrosothiol-derived nitric oxide.
12732622 2003 Prion, amyloid beta-derived Cu(II) ions, or free Zn(II) ions support S-nitroso-dependent autocleavage of glypican-1 heparan sulfate.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12084716 2002 Copper-dependent autocleavage of glypican-1 heparan sulfate by nitric oxide derived from intrinsic nitrosothiols.
11968010 2002 Augmented synthesis and differential localization of heparan sulfate proteoglycans in Duchenne muscular dystrophy.
11454708 2001 Glypican-1 is overexpressed in human breast cancer and modulates the mitogenic effects of multiple heparin-binding growth factors in breast cancer cells.
11375980 2001 Characterization of Slit protein interactions with glypican-1.
11336704 2001 Cell surface glypicans are low-affinity endostatin receptors.
10892742 2000 Repulsive axon guidance: Abelson and Enabled play opposing roles downstream of the roundabout receptor.
10527946 1999 Expression of proteoglycan core proteins in human bone marrow stroma.
10364234 1999 Mammalian homologues of the Drosophila slit protein are ligands of the heparan sulfate proteoglycan glypican-1 in brain.
10196157 1999 Glypican-1 is a VEGF165 binding proteoglycan that acts as an extracellular chaperone for VEGF165.
9802880 1998 The cell-surface heparan sulfate proteoglycan glypican-1 regulates growth factor action in pancreatic carcinoma cells and is overexpressed in human pancreatic cancer.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7774946 1995 Assignment of the human glypican gene (GPC1) to 2q35-q37 by fluorescence in situ hybridization.
2148568 1990 Molecular cloning of a phosphatidylinositol-anchored membrane heparan sulfate proteoglycan from human lung fibroblasts.
1417860 1992 Cloning of a major heparan sulfate proteoglycan from brain and identification as the rat form of glypican.