Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.70
PubTator Score 4.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.6e-03
chronic rhinosinusitis -1.004 2.5e-03
glioblastoma -1.300 7.5e-04
juvenile dermatomyositis 1.019 7.4e-10
medulloblastoma, large-cell -1.200 4.8e-04
osteosarcoma -1.149 2.5e-03
ovarian cancer -1.100 6.1e-05
tuberculosis -1.100 6.9e-04

Gene RIF (3)

AA Sequence

MAQHDFAPAWLNFPTPPSSTKSSLNFEKHSENFAWTENRYDVNRRRHNSSDGFDSAIGRPNGGNFGRKEK      1 - 70
NGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIPDNETGRKEDKRERKQFEAEDFPSL     71 - 140
NPEYEREPNHNKSLAAGVWEYPPNPKSRAPRMLVIKKGNTKDLQLSGFPVVGNLPSQPVKNGTGPSVYKG    141 - 210
LVPKPAAPPTKPTQWKSQTKENKVGTSFPHESTFGVGNFNAFKSTAKNFSPSTNSVKECNRSNSSSPVDK    211 - 280
LNQQPRLTKLTRMRTDKKSEFLKALKRDRVEEEHEDESRAGSEKDDDSFNLHNSNSTHQERDINRNFDEN    281 - 350
EIPQENGNASVISQQIIRSSTFPQTDVLSSSLEAEHRLLKEMGWQEDSENDETCAPLTEDEMREFQVISE    351 - 420
QLQKNGLRKNGILKNGLICDFKFGPWKNSTFKPTTENDDTETSSSDTSDDDDV                     421 - 473
//

Text Mined References (21)

PMID Year Title