Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.70
PubTator Score 4.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.843 2.8e-07
atypical teratoid / rhabdoid tumor -1.100 1.6e-03
glioblastoma -1.300 7.5e-04
medulloblastoma, large-cell -1.200 4.8e-04
juvenile dermatomyositis 1.019 7.4e-10
tuberculosis and treatment for 3 months -1.300 6.9e-04
ovarian cancer 2.100 9.1e-05
chronic rhinosinusitis -1.004 2.5e-03

Gene RIF (3)

PMID Text
17672918 occurrence of an unusual TG 3' splice site in intron 9
12842993 Vasculin is a novel vascular protein differentially expressed in human atherogenesis
11256614 This publication discusses both human and mouse GC-rich promoter binding protein.

AA Sequence

MAQHDFAPAWLNFPTPPSSTKSSLNFEKHSENFAWTENRYDVNRRRHNSSDGFDSAIGRPNGGNFGRKEK      1 - 70
NGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIPDNETGRKEDKRERKQFEAEDFPSL     71 - 140
NPEYEREPNHNKSLAAGVWEYPPNPKSRAPRMLVIKKGNTKDLQLSGFPVVGNLPSQPVKNGTGPSVYKG    141 - 210
LVPKPAAPPTKPTQWKSQTKENKVGTSFPHESTFGVGNFNAFKSTAKNFSPSTNSVKECNRSNSSSPVDK    211 - 280
LNQQPRLTKLTRMRTDKKSEFLKALKRDRVEEEHEDESRAGSEKDDDSFNLHNSNSTHQERDINRNFDEN    281 - 350
EIPQENGNASVISQQIIRSSTFPQTDVLSSSLEAEHRLLKEMGWQEDSENDETCAPLTEDEMREFQVISE    351 - 420
QLQKNGLRKNGILKNGLICDFKFGPWKNSTFKPTTENDDTETSSSDTSDDDDV                     421 - 473
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19060904 2009 An empirical framework for binary interactome mapping.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612417 2003 The murine G+C-rich promoter binding protein mGPBP is required for promoter-specific transcription.
12842993 2003 Vasculin, a novel vascular protein differentially expressed in human atherogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.