Property Summary

Ligand Count 138
NCBI Gene PubMed Count 53
PubMed Score 373.17
PubTator Score 141.14

Knowledge Summary

Patent (31,189)

Expression

  Differential Expression (2)

Disease log2 FC p
fibroadenoma -1.100 2.4e-02
tuberculosis 1.700 8.0e-06

Gene RIF (48)

AA Sequence

MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPT      1 - 70
LPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFAS     71 - 140
LPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDE    141 - 210
PSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAM    211 - 280
GLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN                        281 - 330
//

Text Mined References (53)

PMID Year Title