Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.89
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MFGAAGRQPIGAPAAGNSWHFSRTMEELVHDLVSALEESSEQARGGFAETGDHSRSISCPLKRQARKRRG      1 - 70
RKRRSYNVHHPWETGHCLSEGSDSSLEEPSKDYRENHNNNKKDHSDSDDQMLVAKRRPSSNLNNNVRGKR     71 - 140
PLWHESDFAVDNVGNRTLRRRRKVKRMAVDLPQDISNKRTMTQPPEGCRDQDMDSDRAYQYQEFTKNKVK    141 - 210
KRKLKIIRQGPKIQDEGVVLESEETNQTNKDKMECEEQKVSDELMSESDSSSLSSTDAGLFTNDEGRQGD    211 - 280
DEQSDWFYEKESGGACGITGVVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHG    281 - 350
MSSKNIKKSGGTPTSMVPIPGPVGNKRMVHFSPDSHHHDHWFSPGARTEHDQHQLLRDNRAERGHKKNCS    351 - 420
VRTASRQTSMHLGSLCTGDIKRRRKAAPLPGPTTAGFVGENAQPILENNIGNRMLQNMGWTPGSGLGRDG    421 - 490
KGISEPIQAMQRPKGLGLGFPLPKSTSATTTPNAGKSA                                    491 - 528
//

Text Mined References (18)

PMID Year Title