Property Summary

NCBI Gene PubMed Count 12
PubMed Score 39.58
PubTator Score 8.56

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 1.2e-03


  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.592 1.2e-03

Protein-protein Interaction (5)

Gene RIF (4)

24156295 None of the eleven AGPAT6 variants were robustly associated with type 2 diabetes in the Danish.
20181984 Results reveal a link between the lipogenic effects of insulin and microsomal GPAT3 and GPAT4, implying their importance in glycerolipid biosynthesis.
18238778 AGPAT6 is a microsomal GPAT, and we propose renaming this enzyme GPAT4.
16625827 we have cloned a novel human gene and this gene may play an important role in human spermatogenesis and sexual maturation.

AA Sequence

WDGGLKREKVKDTFKEEQQKLYSKMIVGNHKDRSRS                                      421 - 456

Text Mined References (12)

PMID Year Title
25918168 2015 Glycerol-3-phosphate Acyltransferase Isoform-4 (GPAT4) Limits Oxidation of Exogenous Fatty Acids in Brown Adipocytes.
24156295 2013 Studies of association of AGPAT6 variants with type 2 diabetes and related metabolic phenotypes in 12,068 Danes.
20181984 2010 GPAT3 and GPAT4 are regulated by insulin-stimulated phosphorylation and play distinct roles in adipogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
18238778 2008 AGPAT6 is a novel microsomal glycerol-3-phosphate acyltransferase.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16625827 2006 Molecular cloning and preliminary function study of a novel human gene, TSARG7, related to spermatogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12938015 2003 Cloning and identification of the human LPAAT-zeta gene, a novel member of the lysophosphatidic acid acyltransferase family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8944226 1996 Biosynthesis of triacylglycerols.