Property Summary

NCBI Gene PubMed Count 24
PubMed Score 75.57
PubTator Score 44.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
limb girdle muscular dystrophy 2I -1.142 1.5e-02
Becker muscular dystrophy -1.275 2.2e-02
autosomal dominant Emery-Dreifuss muscul... 1.267 7.4e-03
acute quadriplegic myopathy 1.965 2.2e-05
Atopic dermatitis -2.000 7.8e-03
pancreatic ductal adenocarcinoma liver m... -3.405 3.9e-04
interstitial cystitis -1.100 1.7e-02
adult high grade glioma -1.100 4.2e-03
non primary Sjogren syndrome sicca 1.200 2.1e-02
aldosterone-producing adenoma -1.195 3.2e-02
psoriasis -1.900 7.4e-04
breast carcinoma -2.300 2.0e-14
Pick disease 1.200 1.1e-03
ductal carcinoma in situ -4.300 6.8e-05
invasive ductal carcinoma -5.700 3.9e-05
ovarian cancer -1.300 3.4e-08

Protein-protein Interaction (6)

Gene RIF (7)

PMID Text
22634312 two transcriptional initiation sites and two promoters (promoter I and II) required for expression of the human GPAT1 (hGPAT1) gene were identified.
22070544 Results suggest that GPAM is expressed in human breast cancer with associated changes in the cellular metabolism, in particular an increased synthesis of phospholipids, the major structural component of cellular membranes.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
19209188 Meta-analysis of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDESALTLGTIDVSYLPHSSEYSVGRCKHTSEEWGECGFRPTIFRSATLKWKESLMSRKRPFVGRCCYSC      1 - 70
TPQSWDKFFNPSIPSLGLRNVIYINETHTRHRGWLARRLSYVLFIQERDVHKGMFATNVTENVLNSSRVQ     71 - 140
EAIAEVAAELNPDGSAQQQSKAVNKVKKKAKRILQEMVATVSPAMIRLTGWVLLKLFNSFFWNIQIHKGQ    141 - 210
LEMVKAATETNLPLLFLPVHRSHIDYLLLTFILFCHNIKAPYIASGNNLNIPIFSTLIHKLGGFFIRRRL    211 - 280
DETPDGRKDVLYRALLHGHIVELLRQQQFLEIFLEGTRSRSGKTSCARAGLLSVVVDTLSTNVIPDILII    281 - 350
PVGISYDRIIEGHYNGEQLGKPKKNESLWSVARGVIRMLRKNYGCVRVDFAQPFSLKEYLESQSQKPVSA    351 - 420
LLSLEQALLPAILPSRPSDAADEGRDTSINESRNATDESLRRRLIANLAEHILFTASKSCAIMSTHIVAC    421 - 490
LLLYRHRQGIDLSTLVEDFFVMKEEVLARDFDLGFSGNSEDVVMHAIQLLGNCVTITHTSRNDEFFITPS    491 - 560
TTVPSVFELNFYSNGVLHVFIMEAIIACSLYAVLNKRGLGGPTSTPPNLISQEQLVRKAASLCYLLSNEG    561 - 630
TISLPCQTFYQVCHETVGKFIQYGILTVAEHDDQEDISPSLAEQQWDKKLPEPLSWRSDEEDEDSDFGEE    631 - 700
QRDCYLKVSQSKEHQQFITFLQRLLGPLLEAYSSAAIFVHNFSGPVPEPEYLQKLHKYLITRTERNVAVY    701 - 770
AESATYCLVKNAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLEYILSFVVL                771 - 828
//

Text Mined References (28)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
22634312 2012 Identification and functional characterization of human glycerol-3-phosphate acyltransferase 1 gene promoters.
22070544 2012 Integration of metabolomics and expression of glycerol-3-phosphate acyltransferase (GPAM) in breast cancer-link to patient survival, hormone receptor status, and metabolic profiling.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
19209188 2009 Genetic association analysis of 13 nuclear-encoded mitochondrial candidate genes with type II diabetes mellitus: the DAMAGE study.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18238778 2008 AGPAT6 is a novel microsomal glycerol-3-phosphate acyltransferase.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11546763 2001 Mitochondrial glycerol phosphate acyltransferase directs the incorporation of exogenous fatty acids into triacylglycerol.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9434961 1998 Assignment of Gpam to distal mouse chromosome 19 by linkage analysis.
8944226 1996 Biosynthesis of triacylglycerols.
8369314 1993 Expression and identification of p90 as the murine mitochondrial glycerol-3-phosphate acyltransferase.
2303421 1990 Lipid peroxidation inactivates rat liver microsomal glycerol-3-phosphate acyl transferase. Effect of iron and copper salts and carbon tetrachloride.
2242030 1990 Effect of 3- and 4-thia-substituted fatty acids on glycerolipid metabolism and mitochondrial beta-oxidation in rat liver.