Property Summary

NCBI Gene PubMed Count 29
PubMed Score 394.35
PubTator Score 215.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
25968583 Totals of 12.4% and 20.8% of Crohn's disease patients were positive for IgA/IgG type of anti-GP2 and anti-CUZD1, respectively. Positivity for anti-pancreatic autoantibodies predicted a faster progression towards complicated disease course.
23118780 Anti-GP2 antibody positive CD patients had higher ASCA titres compared to seronegative cases.
22891285 A novel role for GP2 in immune regulation could provide a platform for new therapeutic interventions in the treatment of Crohn disease.
21190681 GP2 is a binding partner of the scavenger receptor expressed on endothelial cells I (SREC-I) but not of SR-AI and SR-BI. Dendritic cells express SREC-I and also bind and internalize GP2.
20335779 GP2 gene is unlikely to play a major role in the etiology of chronic pancreatitis.
20335779 Observational study of gene-disease association. (HuGE Navigator)
19959969 Data suggest that GP2 alterations do not alter the risk for the development of chronic pancreatitis.
19959969 Observational study of gene-disease association. (HuGE Navigator)
19919903 This study represents the first detailed analysis of any variation in the GP2 gene and gives some support to the putative association of c.1275A>G with chronic pancreatitis disease protection.
19907495 glycoprotein 2 (GP2), specifically expressed on the apical plasma membrane of M cells among enterocytes, serves as a transcytotic receptor for mucosal antigens
19627615 GP2 binds to Type 1 fimbria, a bacterial adhesin that is commonly expressed by members of the Enterobacteriacae family.
9605860 According to human genome blasts for Build 35.1, this gene is located on 16p12 not 9q21 as described in this paper.

AA Sequence

MPHLMERMVGSGLLWLALVSCILTQASAVQRGYGNPIEASSYGLDLDCGAPGTPEAHVCFDPCQNYTLLD      1 - 70
EPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACAH     71 - 140
WSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCTVPRDPSTVEDKCEKACRPEEECLALNSTWGCF    141 - 210
CRQDLNSSDVHSLQPQLDCGPREIKVKVDKCLLGGLGLGEEVIAYLRDPNCSSILQTEERNWVSVTSPVQ    211 - 280
ASACRNILERNQTHAIYKNTLSLVNDFIIRDTILNINFQCAYPLDMKVSLQAALQPIVSSLNVSVDGNGE    281 - 350
FIVRMALFQDQNYTNPYEGDAVELSVESVLYVGAILEQGDTSRFNLVLRNCYATPTEDKADLVKYFIIRN    351 - 420
SCSNQRDSTIHVEENGQSSESRFSVQMFMFAGHYDLVFLHCEIHLCDSLNEQCQPSCSRSQVRSEVPAID    421 - 490
LARVLDLGPITRRGAQSPGVMNGTPSTAGFLVAWPMVLLTVLLAWLF                           491 - 537
//

Text Mined References (30)

PMID Year Title
25968583 2015 Rediscovery of the Anti-Pancreatic Antibodies and Evaluation of their Prognostic Value in a Prospective Clinical Cohort of Crohn's Patients: The Importance of Specific Target Antigens [GP2 and CUZD1].
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23118780 2012 Ileal inflammation may trigger the development of GP2-specific pancreatic autoantibodies in patients with Crohn's disease.
22891285 2012 Identification of pancreatic glycoprotein 2 as an endogenous immunomodulator of innate and adaptive immune responses.
22344219 2012 Meta-analysis identifies common variants associated with body mass index in east Asians.
21190681 2011 The zymogen granule protein 2 (GP2) binds to scavenger receptor expressed on endothelial cells I (SREC-I).
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20335779 2010 Genetic analysis of the glycoprotein 2 gene in patients with chronic pancreatitis.
19959969 2010 Mutational analysis of the gene encoding the zymogen granule membrane glycoprotein 2 (GP2) in patients with chronic pancreatitis.
19919903 2010 The c.1275A>G putative chronic pancreatitis-associated synonymous polymorphism in the glycoprotein 2 (GP2) gene decreases exon 9 inclusion.
19907495 2009 Uptake through glycoprotein 2 of FimH(+) bacteria by M cells initiates mucosal immune response.
19627615 2009 The pancreatic zymogen granule membrane protein, GP2, binds Escherichia coli Type 1 fimbriae.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16000323 2005 Whole genome association study of rheumatoid arthritis using 27 039 microsatellites.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12324456 2002 A potential endogenous ligand of annexin IV in the exocrine pancreas. Carbohydrate structure of GP-2, a glycosylphosphatidylinositol-anchored glycoprotein of zymogen granule membranes.
11853552 2002 Interaction of syncollin with GP-2, the major membrane protein of pancreatic zymogen granules, and association with lipid microdomains.
11039464 2000 GP2, a GPI-anchored protein in the apical plasma membrane of the pancreatic acinar cell, co-immunoprecipitates with src kinases and caveolin.
10760606 2000 Molecular cloning and sequences of cDNAs encoding alpha (large) and beta (small) isoforms of human pancreatic zymogen granule membrane-associated protein GP2.
9605860 1997 Assignment of pancreatic zymogen granule membrane protein GP2 (GP2) to human chromosome band 9q21.11 to q21.2 by in situ hybridization.
8666297 1996 Sequence of the cDNA encoding human GP-2, the major membrane protein in the secretory granule of the exocrine pancreas.
7519402 1994 Nonparallel secretion of GP-2 from exocrine pancreas implies luminal coupling between acinar and duct cells.
7503984 1993 Incorporation of the pancreatic membrane protein GP-2 into secretory granules in exocrine but not endocrine cells.
2076702 1990 The pancreatic membrane protein GP-2 localizes specifically to secretory granules and is shed into the pancreatic juice as a protein aggregate.
2011597 1991 A single gene encodes membrane-bound and free forms of GP-2, the major glycoprotein in pancreatic secretory (zymogen) granule membranes.
1651706 1991 In resting conditions, the pancreatic granule membrane protein GP-2 is secreted by cleavage of its glycosylphosphatidylinositol anchor.
1531535 1992 GP-2/THP gene family encodes self-binding glycosylphosphatidylinositol-anchored proteins in apical secretory compartments of pancreas and kidney.
1284286 Specific interactions of pancreatic amylase at acidic pH. Amylase and the major protein of the zymogen granule membrane (GP-2) bind to immobilized or polymerized amylase.