Property Summary

NCBI Gene PubMed Count 54
PubMed Score 168.38
PubTator Score 87.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.200 1.9e-06
astrocytic glioma -2.200 1.9e-03
ependymoma -2.200 5.2e-03
glioblastoma -2.400 6.4e-08
oligodendroglioma -1.700 5.2e-18
medulloblastoma -2.400 6.5e-11
atypical teratoid / rhabdoid tumor -2.200 1.2e-08
medulloblastoma, large-cell -2.100 2.2e-05
primitive neuroectodermal tumor -2.000 4.4e-06
adrenocortical carcinoma -1.180 5.7e-04
tuberculosis and treatment for 3 months -1.200 4.3e-07
pancreatic ductal adenocarcinoma liver m... -1.691 1.6e-02
non-small cell lung cancer 1.018 2.0e-13
pediatric high grade glioma -2.300 3.3e-09
pilocytic astrocytoma -1.900 2.4e-09
non primary Sjogren syndrome sicca 1.200 3.2e-02
subependymal giant cell astrocytoma -1.997 1.8e-02
Pick disease -1.600 6.8e-04
gastric carcinoma -1.300 1.7e-02

Protein-protein Interaction (7)

Gene RIF (27)

PMID Text
26881519 Elevated aspartate aminotransferase level was associated with hepatocellular carcinoma.
26791191 Data suggest that, in context of abnormal hepatic lipid accumulation in nonalcoholic fatty liver disease, circulating GOT1 rises due to up-regulation of hepatic expression of GOT1 associated with greater gluconeogenesis and insulin resistance.
26290281 The serum hepcidin, ferritin, alanine transaminase, aspartate transaminase, gamma-glutamyltransferase and bilirubin were examined in two independent Chinese cohorts consisted of 3455 individuals.
26003525 Human GOT1 was expressed in E coli, purified by affinity chromatography and preliminary crystallographic studies were done.
25595905 We propose the GOT1 expression status as a simple and reliable prognostic biomarker in pancreatic ductal adenocarcinoma
25272068 The aim of this study was to establish the reference intervals (RIs) of total bilirubin (TBIL), alanine aminotransferase (ALT), aspartate transaminase (AST), and creatinine (CREA) for apparently healthy elderly (Han ethnicity) in Shuyang, China.
24849491 Significantly higher GOT levels were found in the 1-20 year age group of type 1
23667618 Alcohol consumption, smoking status, and metabolic syndrome impact on serum levels of aspartate aminotransferase (AST), alanine aminotransferase (ALT), and gamma-glutamyl transferase (GGT), was determined.
22352690 APRI and AST/ALT are independent predictors for significant fibrosis in chronic hepatitis C patients.
22242166 This study highlights the necessity of intensive follow-up for those with elevated AST and ALT levels and comorbid alcohol use disorder for preventing excessive natural deaths.
22132177 The patterns of interaction between smoking and alcohol consumption or BMI with respect to AST and ALT resembled those observed for gamma-GT.
21900944 we discovered a rare in-frame deletion in GOT1 gene, which inactivates cAST enzyme in the Old Order Amish.
21750724 Data indicate that the percentages of CD4(+)CXCR5(+) TFH in IA patients were positively correlated with AST.
20972737 liver enzymes, including AST, were significantly associated with IR according to direct clamp assessment, which were independent of the traditional risk factors in diabetic patients
20499337 Elevated serum LDH isoenzymes and AST indicate a disturbance (of uncertain clinical significance) within multiple extraosseous tissues when there is CLCN7 deficiency.
20205615 The association of coffee and green tea consumption with serum activities of liver enzymes in free-living Japanese men and women was examined, focusing on sex difference and effect modifications of alcohol and obesity.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19393479 the management of patients with pyelonephritis should take into account that moderate and self-limited abnormalities in aminotransferase levels are frequent during the acute phase of the disease
19370784 Results suggest that alanine and aspartate aminotransferase levels and AST/ALT ratio do not seem to be reliable predictors for non-alcoholic steatohepatitis.
19012630 Neither ALT nor GGT concentrations were correlated with ALP concentration, but AST concentration was moderately correlated with ALP concentration.
18752324 Serum bilirubin, alkaline phosphatase, and aspartate aminotransferase are an efficient set of biochemistries to identify UDCA-treated patients with primary biliary cirrhosis at risk of death or liver transplantation (LT).
18242760 Data revealed higher aspartate aminotransferase for women with a family history of diabetes, when adjusted for age and BMI.
17907318 Abnormal serum aminotransferase values are uncommon in severely obese children in France.
17877759 PTLP activity is positively associated with serum ALT1, GOT1 and GOT2 in type 2 diabetes mellitus and metabolic syndrome.
16681433 saliva AST and ALP may have roles in development of periodontal diseases
15306699 mildly elevated in severe acute respiratory syndrome patients during second week after onset of fever.
12480555 Glucose intolerance is associated with elevated serum aminotransferase independent of obesity.

AA Sequence

MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHE      1 - 70
YLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPT     71 - 140
WENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIA    141 - 210
SVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPES    211 - 280
ILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGT    281 - 350
WNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ           351 - 413
//

Text Mined References (61)

PMID Year Title
26881519 Cyclooxygenase-2 expression is associated with elevated aspartate aminotransferase level in hepatocellular carcinoma.
26791191 2016 Serum aminotransferases in nonalcoholic fatty liver disease are a signature of liver metabolic perturbations at the amino acid and Krebs cycle level.
26290281 2015 Elevated serum transaminase activities were associated with increased serum levels of iron regulatory hormone hepcidin and hyperferritinemia risk.
26003525 2015 Expression, purification and preliminary crystallographic studies of human glutamate oxaloacetate transaminase 1 (GOT1).
25595905 2015 GOT1/AST1 expression status as a prognostic biomarker in pancreatic ductal adenocarcinoma.
25272068 2014 Reference intervals for total bilirubin, ALT, AST and creatinine in healthy Chinese elderly.
24849491 2014 A comparative study of glutamate oxaloacetate transaminase (GOT) and glutamate pyruvate transaminase (GPT) levels in the saliva of diabetic and normal patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
23667618 2013 Independent and supra-additive effects of alcohol consumption, cigarette smoking, and metabolic syndrome on the elevation of serum liver enzyme levels.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22633534 2012 Relationship between glutamate, GOT and GPT levels in maternal and fetal blood: a potential mechanism for fetal neuroprotection.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22352690 2012 Association of genetic polymorphism -670A>G in the Fas gene and serum markers AST platelet ratio index, AST/ALT with significant fibrosis and cirrhosis in chronic hepatitis C.
22242166 2012 Elevated aspartate and alanine aminotransferase levels and natural death among patients with methamphetamine dependence.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22132177 2011 Liver enzymes: interaction analysis of smoking with alcohol consumption or BMI, comparing AST and ALT to ?-GT.
21900944 2011 Genome-wide association study identifies genetic variants in GOT1 determining serum aspartate aminotransferase levels.
21750724 2011 High frequency of CD4+ CXCR5+ TFH cells in patients with immune-active chronic hepatitis B.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20972737 2010 Positive correlations of liver enzymes with metabolic syndrome including insulin resistance in newly diagnosed type 2 diabetes mellitus.
20499337 2010 Elevated serum lactate dehydrogenase isoenzymes and aspartate transaminase distinguish Albers-Schönberg disease (Chloride Channel 7 Deficiency Osteopetrosis) among the sclerosing bone disorders.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20205615 2010 Relation of coffee consumption and serum liver enzymes in Japanese men and women with reference to effect modification of alcohol use and body mass index.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19393479 2009 Abnormalities in aminotransferase levels during acute pyelonephritis.
19370784 2009 Non-alcoholic steatohepatitis with normal aminotransferase values.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19012630 2008 The population distributions, upper normal limits and correlations between liver tests among Australian adolescents.
18752324 2008 Biochemical response to ursodeoxycholic acid and long-term prognosis in primary biliary cirrhosis.
18242760 2008 Elevated liver enzymes in women with a family history of diabetes.
17907318 2006 Insulin resistance and ferritin as major determinants of abnormal serum aminotransferase in severely obese children.
17877759 2008 Phospholipid transfer protein activity is determined by type 2 diabetes mellitus and metabolic syndrome, and is positively associated with serum transaminases.
16681433 2006 Salivary aspartate aminotransferase, alanine aminotransferase and alkaline phosphatase: possible markers in periodontal diseases?
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16039064 2005 Amino acids and transaminases activity in ventricular CSF and in brain of normal and Alzheimer patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15306699 2004 Sequential changes of serum aminotransferase levels in patients with severe acute respiratory syndrome.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12480555 2003 Glucose intolerance and serum aminotransferase activities in Japanese men.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10360399 1999 Genetic homogeneity, high-resolution mapping, and mutation analysis of the urofacial (Ochoa) syndrome and exclusion of the glutamate oxaloacetate transaminase gene (GOT1) in the critical region as the disease gene.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8396422 1993 Regulation of the cytosolic aspartate aminotransferase housekeeping gene promoter by glucocorticoids, cAMP, and insulin.
7060339 1982 Multiple molecular forms of human heart cytoplasmic aspartate aminotransferase.
6397370 1984 Structural and genetic relationships between cytosolic and mitochondrial isoenzymes.
6391741 1984 Enzyme immunoassay of human cytosolic aspartate aminotransferase.
3207426 1988 Nucleotide sequence and tissue distribution of the human mitochondrial aspartate aminotransferase mRNA.
2777255 1989 Chromosomal localization of human aspartate aminotransferase genes by in situ hybridization.
2731362 1989 Effects of therapeutic coronary reperfusion on aspartate aminotransferase isoenzymes in sera of patients with acute myocardial infarction.
2241899 1990 The amino acid sequence of cytosolic aspartate aminotransferase from human liver.
2225456 1990 Aspartate aminotransferase isoenzymes.
2182221 1990 New automated measurement of mitochondrial aspartate aminotransferase with use of protease 401.
1974457 1990 Properties of human liver cytosolic aspartate aminotransferase mRNAs generated by alternative polyadenylation site selection.
225064 1979 Apoenzyme of aspartate aminotransferase isozymes in serum and its diagnostic usefullness for hepatic diseases.