Property Summary

NCBI Gene PubMed Count 29
PubMed Score 22.34
PubTator Score 23.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.5e-07
Multiple myeloma 1327 7.7e-04
osteosarcoma 7933 7.8e-04
dermatomyositis 966 1.4e-03
lung cancer 4473 2.3e-03
astrocytoma 1493 8.0e-03
glioblastoma 5572 2.6e-02
non primary Sjogren syndrome sicca 840 4.0e-02
Disease Target Count Z-score Confidence
Exudative vitreoretinopathy 15 3.233 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.423 7.7e-04
osteosarcoma 1.023 7.8e-04
astrocytoma 1.700 8.0e-03
glioblastoma 1.300 2.6e-02
lung cancer 1.200 2.3e-03
non primary Sjogren syndrome sicca 1.200 4.0e-02
ovarian cancer 4.100 1.5e-07
dermatomyositis 1.100 1.4e-03

Gene RIF (10)

PMID Text
25701785 GRASP55 interacts with CD83 shortly after induction of dendritic cells maturation.
24227884 Cisternal-specific functions of GRASP65 and GRASP55 in continuity, compartmentalization, and function of the Golgi ribbon.
23552074 propose that GRASP55/65 are negative regulators of exocytic transport and that this slowdown helps to ensure more complete protein glycosylation in the Golgi stack and proper sorting at the trans-Golgi network
20608975 GRASP55 may function as an adaptor protein coupling MT1-MMP with furin, thus leading to the activation of the zymogen.
20083603 These results demonstrate that GRASP55 and GRASP65 stack mammalian Golgi cisternae via a common mechanism.
19840934 Data demonstrate that both GRASP55 and 65 are needed for the efficient transport to and through the Golgi complex, thus highlighting a novel role for the GRASPs in membrane trafficking.
18976975 Knockdown of golgi reassembly stacking protein 2 (GORASP2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18434598 MEK1/ERK regulation of GRASP55-mediated Golgi linking is a control point in cell cycle progression
11815631 GRASP65 is an important structural component required for maintenance of Golgi apparatus integrity
11739401 GRASP55 forms an effector complex for the small GTPase rab2, together with a conserved coiled-coil protein golgin-45 (JEM-1).

AA Sequence

MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKML      1 - 70
IYSSKTLELRETSVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGAD     71 - 140
TVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPFEEG    141 - 210
KKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGVPTVP    211 - 280
LLPPQVNQSLTSVPPMNPATTLPGLMPLPAGLPNLPNLNLNLPAPHIMPGVGLPELVNPGLPPLPSMPPR    281 - 350
NLPGIAPLPLPSEFLPSFPLVPESSSAASSGELLSSLPPTSNAPSDPATTTAKADAASSLTVDVTPPTAK    351 - 420
APTTVEDRVGDSTPVSEKPVSAAVDANASESP                                          421 - 452
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25701785 2015 CD83 and GRASP55 interact in human dendritic cells.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24227884 2014 Isoform-specific tethering links the Golgi ribbon to maintain compartmentalization.
24136289 2013 Identification and comparative analysis of hepatitis C virus-host cell protein interactions.
23552074 2013 Regulation of protein glycosylation and sorting by the Golgi matrix proteins GRASP55/65.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21884936 2011 Rescue of ?F508-CFTR trafficking via a GRASP-dependent unconventional secretion pathway.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21515684 2011 Structure of the membrane-tethering GRASP domain reveals a unique PDZ ligand interaction that mediates Golgi biogenesis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21235525 2011 The multiple facets of the Golgi reassembly stacking proteins.
20608975 2010 Golgi reassembly stacking protein 55 interacts with membrane-type (MT) 1-matrix metalloprotease (MMP) and furin and plays a role in the activation of the MT1-MMP zymogen.
20083603 2010 GRASP55 and GRASP65 play complementary and essential roles in Golgi cisternal stacking.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19840934 2009 GRASP65 and GRASP55 sequentially promote the transport of C-terminal valine-bearing cargos to and through the Golgi complex.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19361449 2009 Pentameric assembly of potassium channel tetramerization domain-containing protein 5.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18434598 2008 GRASP55 regulates Golgi ribbon formation.
18385516 2008 The role of GRASP55 in Golgi fragmentation and entry of cells into mitosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17607000 2007 Cornichon regulates transport and secretion of TGFalpha-related proteins in metazoan cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16501559 2006 Analysis of the human protein interactome and comparison with yeast, worm and fly interaction datasets.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11815631 2002 Caspase-mediated cleavage of the stacking protein GRASP65 is required for Golgi fragmentation during apoptosis.
11739402 2001 Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus.
11739401 2001 A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic.
11408587 2001 Mitotic phosphorylation of Golgi reassembly stacking protein 55 by mitogen-activated protein kinase ERK2.
11101516 2000 Transmembrane transforming growth factor-alpha tethers to the PDZ domain-containing, Golgi membrane-associated protein p59/GRASP55.
10487747 1999 GRASP55, a second mammalian GRASP protein involved in the stacking of Golgi cisternae in a cell-free system.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.