Property Summary

NCBI Gene PubMed Count 40
PubMed Score 34.79
PubTator Score 48.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.500 9.8e-03
tuberculosis 1.200 2.7e-06
posterior fossa group A ependymoma 1.100 2.2e-08
sonic hedgehog group medulloblastoma -1.200 1.6e-06

Gene RIF (19)

PMID Text
26538023 In cells, Mena and actin were required for Golgi ribbon formation after nocodazole washout; in vitro, Mena and microfilaments enhanced GRASP65 oligomerization and Golgi membrane fusion. Thus Mena interacts with GRASP65 to promote local actin polymerization, which facilitates Golgi ribbon linking.
26363069 Mutagenesis experiments support these structural observations and demonstrate that they are required for GRASP65-GM130 association.
24227884 Cisternal-specific functions of GRASP65 and GRASP55 in continuity, compartmentalization, and function of the Golgi ribbon.
23552074 propose that GRASP55/65 are negative regulators of exocytic transport and that this slowdown helps to ensure more complete protein glycosylation in the Golgi stack and proper sorting at the trans-Golgi network
21567396 HIV-1 Nef causes the FMS N-glycosylation defect and induces relocalization of the GM130 by activating the p56Hck/MEK/ERK/GRASP65 phosphorylation cascade in the Golgi
21368855 The C-terminal fragments of GRASP65 produced following caspase cleavage are targeted to mitochondria, and ectopic expression of these sensitises HeLa cells to Fas ligand.
20937827 the mechanism of phosphoinhibition as direct inhibition by PLK1 of the PDZ ligand underlying the GRASP65 self-interaction.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20214750 GRASP65 has a role in Golgi cisternal stacking and cell cycle progression
20083603 These results demonstrate that GRASP55 and GRASP65 stack mammalian Golgi cisternae via a common mechanism.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19840934 Data demonstrate that both GRASP55 and 65 are needed for the efficient transport to and through the Golgi complex, thus highlighting a novel role for the GRASPs in membrane trafficking.
19581411 Mitochondria bearing GRASP65 became tethered to one another, and this depended on a GRASP65 PDZ domain that was also required for GRASP65 self-interaction.
16489344 Ribbon formation requires the Golgi proteins GM130 and GRASP65.
15888544 GRASP65 has a role in the regulation of spindle dynamics rather than a direct role in the stacking of Golgi cisternae
15834132 GRASP65 may function as a signal integrator controlling the cell growth
15576368 the GRASP domain alone of GRASP65 inhibits mitotic fragmentation of the Golgi apparatus
9628863 A study showing that GRASP65 binds directly to the coiled-coil vesicle tethering factor GM130, and targets it to Golgi membranes.
9346242 Identification of GRASP65, and demonstration that it functions in the formation of stacked Golgi cisternae.

AA Sequence

MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLE      1 - 70
VFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEPSSPAALAGLRPYTDYVVGSD     71 - 140
QILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQPPSYH    141 - 210
KKPPGTPPPSALPLGAPPPDALPPGPTPEDSPSLETGSRQSDYMEALLQAPGSSMEDPLPGPGSPSHSAP    211 - 280
DPDGLPHFMETPLQPPPPVQRVMDPGFLDVSGISLLDNSNASVWPSLPSSTELTTTAVSTSGPEDICSSS    281 - 350
SSHERGGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEG    351 - 420
LDTGTEAEGLDSQAQISTTE                                                      421 - 440
//

Text Mined References (44)

PMID Year Title
26538023 2016 Mena-GRASP65 interaction couples actin polymerization to Golgi ribbon linking.
26363069 2015 Structural basis for the interaction between the Golgi reassembly-stacking protein GRASP65 and the Golgi matrix protein GM130.
25416956 2014 A proteome-scale map of the human interactome network.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24227884 2014 Isoform-specific tethering links the Golgi ribbon to maintain compartmentalization.
23552074 2013 Regulation of protein glycosylation and sorting by the Golgi matrix proteins GRASP55/65.
21572988 2011 An OBSL1-Cul7Fbxw8 ubiquitin ligase signaling mechanism regulates Golgi morphology and dendrite patterning.
21368855 2010 Caspase cleavage of the Golgi stacking factor GRASP65 is required for Fas/CD95-mediated apoptosis.
20937827 2010 Mitotic inhibition of GRASP65 organelle tethering involves Polo-like kinase 1 (PLK1) phosphorylation proximate to an internal PDZ ligand.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20214750 2010 The role of GRASP65 in Golgi cisternal stacking and cell cycle progression.
20083603 2010 GRASP55 and GRASP65 play complementary and essential roles in Golgi cisternal stacking.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19840934 2009 GRASP65 and GRASP55 sequentially promote the transport of C-terminal valine-bearing cargos to and through the Golgi complex.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19581411 2009 Organelle tethering by a homotypic PDZ interaction underlies formation of the Golgi membrane network.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18045989 2008 The Golgi protein GM130 regulates centrosome morphology and function.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16489344 2006 GM130 and GRASP65-dependent lateral cisternal fusion allows uniform Golgi-enzyme distribution.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15888544 2005 The Golgi-associated protein GRASP65 regulates spindle dynamics and is essential for cell division.
15834132 2005 Convergence of cell cycle regulation and growth factor signals on GRASP65.
15678101 2005 Plk1 docking to GRASP65 phosphorylated by Cdk1 suggests a mechanism for Golgi checkpoint signalling.
15576368 2005 Mapping the functional domains of the Golgi stacking factor GRASP65.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12839990 2003 A direct role for GRASP65 as a mitotically regulated Golgi stacking factor.
12543795 2003 An integrated physical and gene map of the 3.5-Mb chromosome 3p21.3 (AP20) region implicated in major human epithelial malignancies.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12111718 2002 Inheriting a structural scaffold for Golgi biosynthesis.
11815631 2002 Caspase-mediated cleavage of the stacking protein GRASP65 is required for Golgi fragmentation during apoptosis.
11781572 2001 The GM130 and GRASP65 Golgi proteins cycle through and define a subdomain of the intermediate compartment.
11739402 2001 Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus.
11739401 2001 A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic.
11706049 2001 Maintenance of Golgi structure and function depends on the integrity of ER export.
11447294 2001 Polo-like kinase is required for the fragmentation of pericentriolar Golgi stacks during mitosis.
11285137 2001 Rab1 interaction with a GM130 effector complex regulates COPII vesicle cis--Golgi tethering.
11050165 2000 Peripheral Golgi protein GRASP65 is a target of mitotic polo-like kinase (Plk) and Cdc2.
9628863 1998 Mapping the interaction between GRASP65 and GM130, components of a protein complex involved in the stacking of Golgi cisternae.
9346242 1997 GRASP65, a protein involved in the stacking of Golgi cisternae.