Property Summary

NCBI Gene PubMed Count 51
PubMed Score 48.45
PubTator Score 49.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 2.405 2.3e-06
atypical teratoid / rhabdoid tumor 1.300 2.3e-05
glioblastoma 1.300 4.2e-05
medulloblastoma 1.400 2.3e-03
medulloblastoma, large-cell 1.800 1.5e-03
Alzheimer's disease -1.100 2.9e-02
Pick disease -1.500 2.1e-06
progressive supranuclear palsy -1.100 1.8e-02
ovarian cancer 1.900 9.3e-06

MLP Assay (8)

AID Type Active / Inconclusive / Inactive Description
504414 screening 54 / 0 / 326957 Fluorescence Polarization with Cer CAL-PDZ Measured in Biochemical System Using Plate Reader - 2109-01_Inhibitor_SinglePoint_HTS_Activity
504435 summary 0 / 0 / 0 Broad Institute Small-molecule targeting of CFTR: PDZ Trafficking Interactions Inhibitor Probe Project
504773 confirmatory 29 / 0 / 424 Fluorescence Polarization with Cer CAL-PDZ Measured in Biochemical System Using Plate Reader - 2109-01_Inhibitor_Dose_CherryPick_Activity
602252 screening 2737 / 31 / 293918 Fluorescence Polarization with CAL-PDZ Measured in Biochemical System Using Plate Reader - 2109-02_Inhibitor_SinglePoint_HTS_Activity
602253 confirmatory 2 / 0 / 6 Fluorescence Polarization with Cer CAL-PDZ Measured in Biochemical System Using Plate Reader - 2109-01_Inhibitor_Dose_DryPowder_Activity
602254 confirmatory 9 / 0 / 1028 Fluorescence Polarization with CAL-PDZ Measured in Biochemical System Using Plate Reader - 2109-02_Inhibitor_Dose_CherryPick_Activity_Set2
602255 confirmatory 4 / 0 / 4 Fluorescence Polarization with CAL-PDZ Measured in Biochemical System Using Plate Reader - 2109-02_Inhibitor_Dose_DryPowder_Activity
602267 confirmatory 13 / 0 / 440 Fluorescence Polarization with CAL-PDZ Measured in Biochemical System Using Plate Reader - 2109-02_Inhibitor_Dose_CherryPick_Activity

Gene RIF (20)

PMID Text
26115868 CAL can regulate the anterograde trafficking, the internalization as well as the signaling of CRFR1 via modulating the post-translational modifications that the receptor undergoes at the Golgi apparatus.
25876703 CAL overexpression retards B2AR expression in Golgi apparatus and reduces the receptor expression in the plasma membrane.
25614626 Our data suggest that PIST contributes to the fine-tuning of b1AR sorting both during biosynthetic and postendocytic trafficking
25231053 Six out of 65 (9%) BTC patients were positive for the FIG-ROS1 fusion, comprising two out of 14 (14%) gallbladder carcinoma (GBC) patients and four out of 25 (16%) extrahepatic cholangiocarcinoma (ECC) patients.
24999209 None of 268 gliomas analysed showed the FIG-ROS1(L) rearrangement.
24210758 Stereochemical preferences modulate affinity and selectivity among CAL PDZ domain protein variants that bind CFTR.
24154728 FIG-ROS fusion protein, which is found in a subset of intrahepatic cholangiocarcinoma patients, accelerates cholangiocarcinogenesis.
23818989 Data indicate that E3 ubiquitin ligase MARCH2 co-immunoprecipitated and co-localized with CAL and syntaxin 6 (STX6), and show the ubiquitination of CFTR by MARCH2.
23545662 The coiled-coil domain of PIST was then purified to homogeneity and crystallized at 293 K. Finally, X-ray diffraction data were collected to a resolution of 4.0 A from a crystal belonging to the hexagonal space group P6(2)22 or P6(4)22.
21543871 crystals of CAL PDZ domain diffracted to 1.4 A resolution
21105033 establish CAL inhibitors as founding members of a class of CFTR "stabilizers" specifically designed to reduce DeltaF508-CFTR post-endocytic breakdown
20130090 Syntaxin 6 and CAL mediate the degradation of the cystic fibrosis transmembrane conductance regulator
18754678 The cystic fibrosis-associated ligand (CAL) PDZ domain of the C-terminus of cystic fibrosis-associated conductance regulator (CFTR) is competitively involved with PDZ proteins Na+/H+ exchanger-3 regulatory factors NHERF1 and NHERF2.
17158866 CAL is a negative regulator of DeltaF508-CFTR cell-surface expression
16882988 Our discoveries provide insight into the specific interaction of the GOPC PDZ domain with the C-terminal peptide of Nlg and also provide a general insight about the possible binding mode of the interaction of Nlg with other PDZ domain-containing proteins.
16012170 intracellular sorting of the somatostatin receptor subtype 5 is regulated by interactions with PDZ domain proteins PIST/GOPC and PDZK1
15951434 golgin-160 assosiates in an isoform-specific manner with the Golgi-associated protein PIST
15358775 modulates beta1AR intracellular trafficking
14570915 CAL retains CFTR in the cell and targets CFTR for degradation.
12661006 The FIG-ROS locus encodes for an in-frame fusion protein with a constitutively active kinase activity, suggesting that FIG-ROS may act as an oncogene.

AA Sequence

MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKM      1 - 70
TSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQS     71 - 140
ADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYL    141 - 210
DKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKS    211 - 280
QGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHK    281 - 350
EAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQG    351 - 420
FNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY                                421 - 462
//

Text Mined References (54)

PMID Year Title
26179146 2015 FAM170B, a novel acrosomal protein involved in fertilization in mice.
26115868 2015 Role of cystic fibrosis transmembrane conductance regulator-associated ligand (CAL) in regulating the trafficking and signaling of corticotropin-releasing factor receptor 1.
25876703 2015 Regulation of ?2-adrenergic receptor cell surface expression by interaction with cystic fibrosis transmembrane conductance regulator-associated ligand (CAL).
25614626 2015 The golgi-associated PDZ domain protein PIST/GOPC stabilizes the ?1-adrenergic receptor in intracellular compartments after internalization.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25231053 2014 Screening for the FIG-ROS1 fusion in biliary tract carcinomas by nested PCR.
24999209 2014 Lack of GOPC-ROS1 (FIG-ROS1) rearrangement in adult human gliomas.
24210758 2014 Stereochemical preferences modulate affinity and selectivity among five PDZ domains that bind CFTR: comparative structural and sequence analyses.
24154728 2013 Mouse model of intrahepatic cholangiocarcinoma validates FIG-ROS as a potent fusion oncogene and therapeutic target.
23966943 2013 PIST (GOPC) modulates the oncogenic voltage-gated potassium channel KV10.1.
23818989 2013 Ubiquitination and degradation of CFTR by the E3 ubiquitin ligase MARCH2 through its association with adaptor proteins CAL and STX6.
23545662 2013 Crystallization and preliminary X-ray crystallographic studies of the coiled-coil domain of PIST.
23266556 2013 Identification of Genetic Susceptibility Loci for Colorectal Tumors in a Genome-Wide Meta-analysis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21543871 2011 Crystallization and preliminary diffraction analysis of the CAL PDZ domain in complex with a selective peptide inhibitor.
21269460 2011 Initial characterization of the human central proteome.
21105033 2010 A stabilizing influence: CAL PDZ inhibition extends the half-life of ?F508-CFTR.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20130090 2010 Syntaxin 6 and CAL mediate the degradation of the cystic fibrosis transmembrane conductance regulator.
19027007 2008 A novel association of mGluR1a with the PDZ scaffold protein CAL modulates receptor activity.
18754678 2008 The relative binding affinities of PDZ partners for CFTR: a biochemical basis for efficient endocytic recycling.
18468998 2008 Blood pressure is regulated by an alpha1D-adrenergic receptor/dystrophin signalosome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17158866 2007 Targeting CAL as a negative regulator of DeltaF508-CFTR cell-surface expression: an RNA interference and structure-based mutagenetic approach.
16882988 2006 Solution structure of GOPC PDZ domain and its interaction with the C-terminal motif of neuroligin.
16646955 2006 Identification of a PDZ protein, PIST, as a binding partner for Rho effector Rhotekin: biochemical and cell-biological characterization of Rhotekin-PIST interaction.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16316992 2006 Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins.
16192284 2005 Yeast kinetochore microtubule dynamics analyzed by high-resolution three-dimensional microscopy.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16012170 2005 Interactions with PDZ domain proteins PIST/GOPC and PDZK1 regulate intracellular sorting of the somatostatin receptor subtype 5.
15951434 2005 Isoform-specific interaction of golgin-160 with the Golgi-associated protein PIST.
15546864 2005 Regulation of cystic fibrosis transmembrane regulator trafficking and protein expression by a Rho family small GTPase TC10.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358775 2004 Interaction with cystic fibrosis transmembrane conductance regulator-associated ligand (CAL) inhibits beta1-adrenergic receptor surface expression.
15317815 2004 PSD-95 and Lin-7b interact with acid-sensing ion channel-3 and have opposite effects on H+- gated current.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14570915 2004 Modulation of mature cystic fibrosis transmembrane regulator protein by the PDZ domain protein CAL.
12885772 2003 CALEB/NGC interacts with the Golgi-associated protein PIST.
12661006 2003 Fusion of FIG to the receptor tyrosine kinase ROS in a glioblastoma with an interstitial del(6)(q21q21).
12538861 2003 Oncogenic targeting of an activated tyrosine kinase to the Golgi apparatus in a glioblastoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471024 2003 The PDZ-binding chloride channel ClC-3B localizes to the Golgi and associates with cystic fibrosis transmembrane conductance regulator-interacting PDZ proteins.
12372286 2002 A novel protein complex linking the delta 2 glutamate receptor and autophagy: implications for neurodegeneration in lurcher mice.
12149515 2002 Lack of acrosome formation in mice lacking a Golgi protein, GOPC.
11707463 2002 A Golgi-associated PDZ domain protein modulates cystic fibrosis transmembrane regulator plasma membrane expression.
11520064 2001 Identification of a PDZ domain containing Golgi protein, GOPC, as an interaction partner of frizzled.
11384996 2001 Association of a novel PDZ domain-containing peripheral Golgi protein with the Q-SNARE (Q-soluble N-ethylmaleimide-sensitive fusion protein (NSF) attachment protein receptor) protein syntaxin 6.
11162552 2001 PIST: a novel PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10.
9843494 1998 Perturbation of Hsp90 interaction with nascent CFTR prevents its maturation and accelerates its degradation by the proteasome.