Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.85
PubTator Score 2.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.334 1.4e-03
cutaneous lupus erythematosus 1.100 3.4e-04
osteosarcoma 2.112 2.9e-05
juvenile dermatomyositis 1.245 4.1e-10
acute quadriplegic myopathy 1.085 2.3e-04
tuberculosis and treatment for 3 months -1.100 4.0e-05
active Crohn's disease 1.074 1.2e-02
diabetes mellitus -1.200 4.8e-03
Pick disease -1.300 1.4e-04
Breast cancer 1.100 3.1e-08
ulcerative colitis 1.200 2.5e-06
ovarian cancer 2.000 1.0e-03

 GO Function (1)

AA Sequence

MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGF      1 - 70
FLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV       71 - 138
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
19946888 2010 Defining the membrane proteome of NK cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414650 2002 Genomic and expression analysis of the 12p11-p12 amplicon using EST arrays identifies two novel amplified and overexpressed genes.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
10406798 1999 Got1p and Sft2p: membrane proteins involved in traffic to the Golgi complex.