Property Summary

NCBI Gene PubMed Count 88
PubMed Score 123.30
PubTator Score 124.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.300 2.9e-02
Astrocytoma, Pilocytic 1.400 1.0e-08
Barrett's esophagus 3.000 4.2e-02
breast carcinoma 1.400 1.4e-05
ductal carcinoma in situ 1.700 7.6e-04
ependymoma 1.400 3.1e-11
esophageal adenocarcinoma 3.600 1.8e-02
lung adenocarcinoma 1.600 2.0e-15
lung carcinoma 1.400 4.7e-13
non-small cell lung cancer 1.915 1.5e-15
ovarian cancer -2.600 2.0e-09
pancreatic cancer 1.400 1.4e-05
primary pancreatic ductal adenocarcinoma 1.387 3.9e-02
psoriasis -1.600 4.8e-03
tuberculosis 1.500 1.3e-04

Gene RIF (75)

AA Sequence

MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEF      1 - 70
QGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQ     71 - 140
FQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRL    141 - 210
QAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVV    211 - 280
EDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD    281 - 350
YNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL                       351 - 401
//

Text Mined References (94)

PMID Year Title