Property Summary

NCBI Gene PubMed Count 27
PubMed Score 44.38
PubTator Score 44.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.137 2.4e-05
Becker muscular dystrophy -1.009 1.9e-02
hereditary spastic paraplegia -1.623 4.6e-04
Breast cancer 2.800 2.7e-02
acute myeloid leukemia 2.200 3.9e-02
ovarian cancer 1.100 1.3e-02

 GO Function (1)

Gene RIF (11)

PMID Text
25496667 Genome-wide shRNA screening identifies GOLGA4, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25436429 p230 is an important molecule in phagophore formation, although it remains unclear whether p230 has any role in late steps of autophagy
24825317 Genome-wide shRNA screening identifies GOLGA4, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
21900423 Genome-wide shRNA screening identifies GOLGA4, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
18849489 CD99 also binds p230/golgin-245, a coiled-coil protein that recycles between the cytosol and buds/vesicles of the TGN and which plays a fundamental role in trafficking transport vesicles.
18394601 The protein CrpF46 has an apparent molecular mass of ~60 kDa, is highly homologous to a 527 amino acid sequence of the C-terminal portion of the protein Golgin-245, and appears to be a splice variant of Golgin-245.
18308930 golgin-245 is a key regulator of TNF secretion; LPS activation of macrophages results in increased Golgi carriers for export, up-regulating the transport pathway for TNF export.
15870108 tGolgin-1 functions in Golgi positioning indirectly, probably by regulating retrograde movement of cargo required for recruitment or activation of dynein-dynactin complexes on newly formed Golgi elements.
15654769 The ability of the four mammalian GRIP domain proteins, p230, golgin-97, GCC88, and GCC185 to interact is reported.
15265687 P230, through its interaction with MACF1, provides the molecular link for transport of GPI-anchored proteins along the microtubule and actin cytoskeleton from the TGN to the cell periphery.
14718928 crystal structure of Arl1-GTP in complex with the GRIP domain of golgin-245 shows that Arl1-GTP interacts with the GRIP domain predominantly in a hydrophobic manner, with the switch II region conferring the main recognition surface

AA Sequence

MFKKLKQKISEEQQQLQQALAPAQASSNSSTPTRMRSRTSSFTEQLDEGTPNRESGDTQSFAQKLQLRVP      1 - 70
SVESLFRSPIKESLFRSSSKESLVRTSSRESLNRLDLDSSTASFDPPSDMDSEAEDLVGNSDSLNKEQLI     71 - 140
QRLRRMERSLSSYRGKYSELVTAYQMLQREKKKLQGILSQSQDKSLRRIAELREELQMDQQAKKHLQEEF    141 - 210
DASLEEKDQYISVLQTQVSLLKQRLRNGPMNVDVLKPLPQLEPQAEVFTKEENPESDGEPVVEDGTSVKT    211 - 280
LETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLDERLQELEKIKDLHMAEKTKLITQLRD    281 - 350
AKNLIEQLEQDKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERAAFEELEKAL    351 - 420
STAQKTEEARRKLKAEMDEQIKTIEKTSEEERISLQQELSRVKQEVVDVMKKSSEEQIAKLQKLHEKELA    421 - 490
RKEQELTKKLQTREREFQEQMKVALEKSQSEYLKISQEKEQQESLALEELELQKKAILTESENKLRDLQQ    491 - 560
EAETYRTRILELESSLEKSLQENKNQSKDLAVHLEAEKNKHNKEITVMVEKHKTELESLKHQQDALWTEK    561 - 630
LQVLKQQYQTEMEKLREKCEQEKETLLKDKEIIFQAHIEEMNEKTLEKLDVKQTELESLSSELSEVLKAR    631 - 700
HKLEEELSVLKDQTDKMKQELEAKMDEQKNHHQQQVDSIIKEHEVSIQRTEKALKDQINQLELLLKERDK    701 - 770
HLKEHQAHVENLEADIKRSEGELQQASAKLDVFQSYQSATHEQTKAYEEQLAQLQQKLLDLETERILLTK    771 - 840
QVAEVEAQKKDVCTELDAHKIQVQDLMQQLEKQNSEMEQKVKSLTQVYESKLEDGNKEQEQTKQILVEKE    841 - 910
NMILQMREGQKKEIEILTQKLSAKEDSIHILNEEYETKFKNQEKKMEKVKQKAKEMQETLKKKLLDQEAK    911 - 980
LKKELENTALELSQKEKQFNAKMLEMAQANSAGISDAVSRLETNQKEQIESLTEVHRRELNDVISIWEKK    981 - 1050
LNQQAEELQEIHEIQLQEKEQEVAELKQKILLFGCEKEEMNKEITWLKEEGVKQDTTLNELQEQLKQKSA   1051 - 1120
HVNSLAQDETKLKAHLEKLEVDLNKSLKENTFLQEQLVELKMLAEEDKRKVSELTSKLKTTDEEFQSLKS   1121 - 1190
SHEKSNKSLEDKSLEFKKLSEELAIQLDICCKKTEALLEAKTNELINISSSKTNAILSRISHCQHRTTKV   1191 - 1260
KEALLIKTCTVSELEAQLRQLTEEQNTLNISFQQATHQLEEKENQIKSMKADIESLVTEKEALQKEGGNQ   1261 - 1330
QQAASEKESCITQLKKELSENINAVTLMKEELKEKKVEISSLSKQLTDLNVQLQNSISLSEKEAAISSLR   1331 - 1400
KQYDEEKCELLDQVQDLSFKVDTLSKEKISALEQVDDWSNKFSEWKKKAQSRFTQHQNTVKELQIQLELK   1401 - 1470
SKEAYEKDEQINLLKEELDQQNKRFDCLKGEMEDDKSKMEKKESNLETELKSQTARIMELEDHITQKTIE   1471 - 1540
IESLNEVLKNYNQQKDIEHKELVQKLQHFQELGEEKDNRVKEAEEKILTLENQVYSMKAELETKKKELEH   1541 - 1610
VNLSVKSKEEELKALEDRLESESAAKLAELKRKAEQKIAAIKKQLLSQMEEKEEQYKKGTESHLSELNTK   1611 - 1680
LQEREREVHILEEKLKSVESSQSETLIVPRSAKNVAAYTEQEEADSQGCVQKTYEEKISVLQRNLTEKEK   1681 - 1750
LLQRVGQEKEETVSSHFEMRCQYQERLIKLEHAEAKQHEDQSMIGHLQEELEEKNKKYSLIVAQHVEKEG   1751 - 1820
GKNNIQAKQNLENVFDDVQKTLQEKELTCQILEQKIKELDSCLVRQKEVHRVEMEELTSKYEKLQALQQM   1821 - 1890
DGRNKPTELLEENTEEKSKSHLVQPKLLSNMEAQHNDLEFKLAGAEREKQKLGKEIVRLQKDLRMLRKEH   1891 - 1960
QQELEILKKEYDQEREEKIKQEQEDLELKHNSTLKQLMREFNTQLAQKEQELEMTIKETINKAQEVEAEL   1961 - 2030
LESHQEETNQLLKKIAEKDDDLKRTAKRYEEILDAREEEMTAKVRDLQTQLEELQKKYQQKLEQEENPGN   2031 - 2100
DNVTIMELQTQLAQKTTLISDSKLKEQEFREQIHNLEDRLKKYEKNVYATTVGTPYKGGNLYHTDVSLFG   2101 - 2170
EPTEFEYLRKVLFEYMMGRETKTMAKVITTVLKFPDDQTQKILEREDARLMFTSPRSGIF             2171 - 2230
//

Text Mined References (36)

PMID Year Title
25436429 2015 Trans-Golgi protein p230/golgin-245 is involved in phagophore formation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22705394 2012 A molecular network for the transport of the TI-VAMP/VAMP7 vesicles from cell center to periphery.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19224922 2009 Differential effects of depletion of ARL1 and ARFRP1 on membrane trafficking between the trans-Golgi network and endosomes.
18849489 2009 Regulation of HLA class I surface expression requires CD99 and p230/golgin-245 interaction.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18394601 2008 Identification of a novel centrosomal protein CrpF46 involved in cell cycle progression and mitosis.
18308930 2008 A trans-Golgi network golgin is required for the regulated secretion of TNF in activated macrophages in vivo.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15870108 2005 tGolgin-1 (p230, golgin-245) modulates Shiga-toxin transport to the Golgi and Golgi motility towards the microtubule-organizing centre.
15654769 2005 The trans-Golgi network GRIP-domain proteins form alpha-helical homodimers.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15265687 2004 Interaction between p230 and MACF1 is associated with transport of a glycosyl phosphatidyl inositol-anchored protein from the Golgi to the cell periphery.
14718928 2004 Structural basis for recruitment of GRIP domain golgin-245 by small GTPase Arl1.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14580338 2003 Structural basis for Arl1-dependent targeting of homodimeric GRIP domains to the Golgi apparatus.
12972563 2003 Interaction of Arl1-GTP with GRIP domains recruits autoantigens Golgin-97 and Golgin-245/p230 onto the Golgi.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11303027 2001 ADP-ribosylation factors (ARFs) and ARF-like 1 (ARL1) have both specific and shared effectors: characterizing ARL1-binding proteins.
11149944 2001 Serological detection of cutaneous T-cell lymphoma-associated antigens.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10231028 1999 Characterization of a 1200-kb genomic segment of chromosome 3p22-p21.3.
10209123 1999 A novel Rab6-interacting domain defines a family of Golgi-targeted coiled-coil proteins.
9013329 1996 p230 is associated with vesicles budding from the trans-Golgi network.
8626529 1996 Molecular characterization of trans-Golgi p230. A human peripheral membrane protein encoded by a gene on chromosome 6p12-22 contains extensive coiled-coil alpha-helical domains and a granin motif.
8537393 1995 Molecular characterization of Golgin-245, a novel Golgi complex protein containing a granin signature.
1400343 1992 Human autoantibodies as reagents to conserved Golgi components. Characterization of a peripheral, 230-kDa compartment-specific Golgi protein.