Property Summary

NCBI Gene PubMed Count 27
PubMed Score 20.33
PubTator Score 26.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.500 4.6e-05
osteosarcoma -1.632 4.1e-05
intraductal papillary-mucinous adenoma (... 1.400 2.1e-03
intraductal papillary-mucinous carcinoma... 1.100 3.9e-03
ovarian cancer 2.300 4.6e-07

Pathway (1)

Gene RIF (11)

PMID Text
24566136 The golgin-160 binds directly to the third intracellular loop of beta1AR and that this binding depends on three basic residues in this loop.
22814606 Golgi protein golgin160 recruits dynein to Golgi membranes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20170975 A common epitope of proteins golgin-160, voltage-gated potassium channel and disulfide isomerase was identified by screening with autoantibodies of a type 1 diabetic patient
17711851 nuclear translocation of golgin-160-(140-311) is a highly coordinated event regulated not only by cleavage of the golgin-160 head but also by the oxidation state of GCP60
17118120 golgin-160 may promote efficient surface delivery of a subset of cargo molecules
16870622 GCP60 interacts preferentially with one of the golgin-160 caspase cleavage fragments (residues 140-311). This strong interaction prevented the golgin-160 fragment from accumulating in the nucleus when this fragment and GCP60 were overexpressed.
15951434 golgin-160 assosiates in an isoform-specific manner with the Golgi-associated protein PIST
15829563 Caspase-resistant GOLGA3 disrupts apoptosis induced by secretory pathway stress and ligation of death receptors.
14522980 results indicate that GCP16 is the acylated membrane protein, associated with GCP170, and possibly involved in vesicular transport from the Golgi to the cell surface
12130652 NH2 terminal domain of Golgin 160 has a role in nuclear transport and Golgi apparatus localization

AA Sequence

MDGASAEQDGLQEDRSHSGPSSLPEAPLKPPGPLVPPDQQDKVQCAEVNRASTEGESPDGPGQGGLCQNG      1 - 70
PTPPFPDPPSSLDPTTSPVGPDASPGVAGFHDNLRKSQGTSAEGSVRKEALQSLRLSLPMQETQLCSTDS     71 - 140
PLPLEKEEQVRLQARKWLEEQLKQYRVKRQQERSSQPATKTRLFSTLDPELMLNPENLPRASTLAMTKEY    141 - 210
SFLRTSVPRGPKVGSLGLPAHPREKKTSKSSKIRSLADYRTEDSNAGNSGGNVPAPDSTKGSLKQNRSSA    211 - 280
ASVVSEISLSPDTDDRLENTSLAGDSVSEVDGNDSDSSSYSSASTRGTYGILSKTVGTQDTPYMVNGQEI    281 - 350
PADTLGQFPSIKDVLQAAAAEHQDQGQEVNGEVRSRRDSICSSVSLESSAAETQEEMLQVLKEKMRLEGQ    351 - 420
LEALSLEASQALKEKAELQAQLAALSTKLQAQVECSHSSQQRQDSLSSEVDTLKQSCWDLERAMTDLQNM    421 - 490
LEAKNASLASSNNDLQVAEEQYQRLMAKVEDMQRSMLSKDNTVHDLRQQMTALQSQLQQVQLERTTLTSK    491 - 560
LKASQAEISSLQSVRQWYQQQLALAQEARVRLQGEMAHIQVGQMTQAGLLEHLKLENVSLSQQLTETQHR    561 - 630
SMKEKGRIAAQLQGIEADMLDQEAAFMQIQEAKTMVEEDLQRRLEEFEGERERLQRMADSAASLEQQLEQ    631 - 700
VKLTLLQRDQQLEALQQEHLDLMKQLTLTQEALQSREQSLDALQTHYDELQARLGELQGEAASREDTICL    701 - 770
LQNEKIILEAALQAAKSGKEELDRGARRLEEGTEETSETLEKLREELAIKSGQVEHLQQETAALKKQMQK    771 - 840
IKEQFLQQKVMVEAYRRDATSKDQLISELKATRKRLDSELKELRQELMQVHGEKRTAEAELSRLHREVAQ    841 - 910
VRQHMADLEGHLQSAQKERDEMETHLQSLQFDKEQMVAVTEANEALKKQIEELQQEARKAITEQKQKMRR    911 - 980
LGSDLTSAQKEMKTKHKAYENAVGILSRRLQEALAAKEAADAELGQLRAQGGSSDSSLALHERIQALEAE    981 - 1050
LQAVSHSKTLLEKELQEVIALTSQELEESREKVLELEDELQESRGFRKKIKRLEESNKKLALELEHEKGK   1051 - 1120
LTGLGQSNAALREHNSILETALAKREADLVQLNLQVQAVLQRKEEEDRQMKHLVQALQASLEKEKEKVNS   1121 - 1190
LKEQVAAAKVEAGHNRRHFKAASLELSEVKKELQAKEHLVQKLQAEADDLQIREGKHSQEIAQFQAELAE   1191 - 1260
ARAQLQLLQKQLDEQLSKQPVGNQEMENLKWEVDQKEREIQSLKQQLDLTEQQGRKELEGLQQLLQNVKS   1261 - 1330
ELEMAQEDLSMTQKDKFMLQAKVSELKNNMKTLLQQNQQLKLDLRRGAAKTRKEPKGEASSSNPATPIKI   1331 - 1400
PDCPVPASLLEELLRPPPAVSKEPLKNLNSCLQQLKQEMDSLQRQMEEHALTVHESLSSWTPLEPATASP   1401 - 1470
VPPGGHAGPRGDPQRHSQSRASKEGPGE                                             1471 - 1498
//

Text Mined References (34)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24566136 2014 Three basic residues of intracellular loop 3 of the beta-1 adrenergic receptor are required for golgin-160-dependent trafficking.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814606 2012 Golgin160 recruits the dynein motor to position the Golgi apparatus.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20170975 2010 Identification of a common autoantigenic epitope of protein disulfide isomerase, golgin-160 and voltage-gated potassium channel in type 1 diabetes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17711851 2007 Identification of a redox-sensitive cysteine in GCP60 that regulates its interaction with golgin-160.
17118120 2006 Golgin-160 promotes cell surface expression of the beta-1 adrenergic receptor.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16870622 2006 GCP60 preferentially interacts with a caspase-generated golgin-160 fragment.
16341674 2005 Transcriptome analysis of human gastric cancer.
15951434 2005 Isoform-specific interaction of golgin-160 with the Golgi-associated protein PIST.
15829563 2005 Caspase-resistant Golgin-160 disrupts apoptosis induced by secretory pathway stress and ligation of death receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14522980 2003 Identification and characterization of GCP16, a novel acylated Golgi protein that interacts with GCP170.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12130652 2002 The NH2-terminal domain of Golgin-160 contains both Golgi and nuclear targeting information.
12036294 2002 Identification and characterization of cDNAs encoding four novel proteins that interact with translin associated factor-X.
10791974 2000 Caspase-2 is localized at the Golgi complex and cleaves golgin-160 during apoptosis.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10209123 1999 A novel Rab6-interacting domain defines a family of Golgi-targeted coiled-coil proteins.
9295333 1997 Molecular characterization of GCP170, a 170-kDa protein associated with the cytoplasmic face of the Golgi membrane.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8315394 1993 Molecular characterization of two human autoantigens: unique cDNAs encoding 95- and 160-kD proteins of a putative family in the Golgi complex.