Property Summary

NCBI Gene PubMed Count 17
PubMed Score 14.84
PubTator Score 16.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 7.7e-09
osteosarcoma 7933 1.0e-05
astrocytoma 1493 4.1e-03
Disease Target Count Z-score Confidence
DiGeorge syndrome 46 3.255 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.405 1.0e-05
astrocytoma 1.100 4.1e-03
ovarian cancer -1.500 7.7e-09

Synonym

Accession Q92805 Q5T164 Q8IYZ9
Symbols golgin-97

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (7)

Gene RIF (8)

PMID Text
22190034 HIV-1 PR is identified to have a physical interaction with golgin A1 (GOLGA1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20610657 FIP1/RCP binding to Golgin-97 is required for tethering and fusion of recycling endosome-derived retrograde transport vesicles to the trans-Golgi network.
20583170 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17276477 Using RNA interference approach, it was demonstrated that a cellular trans-Golgi network membrane protein, golgin-97, is essential for Vaccinia virus replication.
16262725 Selective and essential component of the tubulovesicular carriers transporting E-cadherin out of the trans-Golgi network.
15654769 The ability of the four mammalian GRIP domain proteins, p230, golgin-97, GCC88, and GCC185 to interact is reported.
15269279 Data show that Arl1 regulates the membrane recruitment of Golgin-97, which plays a role in transport from the endosome to the trans-Golgi network.

AA Sequence

MFAKLKKKIAEETAVAQRPGGATRIPRSVSKESVASMGADSGDDFASDGSSSREDLSSQLLRRNEQIRKL      1 - 70
EARLSDYAEQVRNLQKIKEKLEIALEKHQDSSMRKFQEQNETFQANRAKMAEGLALALARKDQEWSEKMD     71 - 140
QLEKEKNILTAQLQEMKNQSMNLFQRRDEMDELEGFQQQELSKIKHMLLKKEESLGKMEQELEARTRELS    141 - 210
RTQEELMNSNQMSSDLSQKLEELQRHYSTLEEQRDHVIASKTGAESKITALEQKEQELQALIQQLSIDLQ    211 - 280
KVTAETQEKEDVITHLQEKVASLEKRLEQNLSGEEHLQELLKEKTLAEQNLEDTRQQLLAARSSQAKAIN    281 - 350
TLETRVRELEQTLQASEEQLQQSKGIVAAQETQIQELAAANQESSHVQQQALALEQQFLERTQALEAQIV    351 - 420
ALERTRAADQTTAEQGMRQLEQENAALKECRNEYERSLQNHQFELKKLKEEWSQREIVSVAMAQALEEVR    421 - 490
KQREEFQQQAANLTAIIDEKEQNLREKTEVLLQKEQEILQLERGHNSALLQIHQLQAELEALRTLKAEEA    491 - 560
AVVAEQEDLLRLRGPLQAEALSVNESHVTSRAMQDPVFQLPTAGRTPNGEVGAMDLTQLQKEKQDLEQQL    561 - 630
LEKNKTIKQMQQRMLELRKTLQKELKIRPDNELFEVREKPGPEMANMAPSVTNNTDLTDAREINFEYLKH    631 - 700
VVLKFMSCRESEAFHLIKAVSVLLNFSQEEENMLKETLEYKMSWFGSKPAPKGSIRPSISNPRIPWS       701 - 767
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20610657 2010 FIP1/RCP binding to Golgin-97 regulates retrograde transport from recycling endosomes to the trans-Golgi network.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17724343 2007 Spatial regulation of Raf kinase signaling by RKTG.
17488291 2007 The trans-Golgi network golgin, GCC185, is required for endosome-to-Golgi transport and maintenance of Golgi structure.
17276477 2007 A host cell membrane protein, golgin-97, is essential for poxvirus morphogenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16262725 2005 E-cadherin transport from the trans-Golgi network in tubulovesicular carriers is selectively regulated by golgin-97.
15654769 2005 The trans-Golgi network GRIP-domain proteins form alpha-helical homodimers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15269279 2004 Autoantigen Golgin-97, an effector of Arl1 GTPase, participates in traffic from the endosome to the trans-golgi network.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972563 2003 Interaction of Arl1-GTP with GRIP domains recruits autoantigens Golgin-97 and Golgin-245/p230 onto the Golgi.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10209123 1999 A novel Rab6-interacting domain defines a family of Golgi-targeted coiled-coil proteins.
9324025 1997 Molecular cloning of a novel 97-kd Golgi complex autoantigen associated with Sjögren's syndrome.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.