Property Summary

NCBI Gene PubMed Count 125
PubMed Score 425.12
PubTator Score 603.81

Knowledge Summary

Patent (13,868)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.500 3.3e-03
pituitary cancer -2.400 1.1e-02
psoriasis 2.000 5.2e-19

Gene RIF (100)

PMID Text
26644469 analysis of information transfer via gonadotropin-releasing hormone receptors to extracellular signal-regulated kinase or nuclear factor of activated T-cells
26308290 Data suggest differences in regulation of expression of PEDF (up-regulation) vs. VEGF (down-regulation) in granulosa cells explain reduced risk of ovarian hyperstimulation syndrome due to ovulation induction using GnRH/GNRHR agonists rather than hCG.
26044071 Results show that biallelic gonadotropin releasing hormone receptor (GNRHR) mutations are not a frequent cause of age-related androgen decline in men.
25592315 A high prevalence of endometriosis, polymorphism in the LHCGR and GnRH1 and progonadoliberin-2 antibodies in serum was found among the patients with severe dysmotility after treatment with GnRH analogs.
25531638 study found a novel mutation in PROK2 in two male siblings presenting normosmic congenital hypogonadotropic hypogonadism, in whom a mutation in the GNRHR gene had been previously described, suggesting the possibility of a digenic inheritance
25293576 GnRH receptors on triple negative breast cancer cells can be used for targeted therapy of these cancers with GnRH agonist triptorelin
25016926 Mutations in GNRHR do not appear to be involved in the pathogenesis of constitutional delay of growth and puberty.
24732674 Mutations were found in the following genes in one or more patients with congenital hypogonadotropic hypogonadism: KAL1, FGFR1, GNRHR, and CHD7
24685158 Interaction between ER-associated Hsp40s and the Vps34 complex permits the selective degradation of ERAD-resistant membrane protein GNRHR via ERQC autophagy.
24472523 GnRH, through heterotopic expression of its receptor, may be a potential regulator of CYP11B2 expression levels in some cases of aldosterone-producing adenoma.
24002956 No abnormalities were found in the patient group for the PROKR2 and GNRH1genes. In addition, no genomic rearrangements were identified in the healthy control individuals for the described genes
23994024 Studies of the gonadotrope suggest that extracellular regulatory loops may play a central role in the regulation of gonadotropin gene expression by gonadotropin-releasing hormone (GnRH) receptor activation.
23891857 A species specific motif participates in recognition of endoplasmic reticulum retention of the GnRHR by calnexin.
23632635 We have generated human GNRHR1 knock-in mice and described their reproductive phenotype.
23380421 The GnRH receptor is differentially expressed in pituitary gonadotrope cells vs. prostate cancer cells.
23287110 GnRHI, GnRHII and GnRH receptor expression correlated significantly with poor prognosis in breast cancer patients
23233674 SET protein interacts with intracellular domains of the gonadotropin-releasing hormone receptor and differentially regulates receptor signaling to cAMP and calcium in gonadotrope cells
23176180 Data show that GnRHR activation affected several cellular markers of locomotion, including actin organization and polymerization as well as active RhoA-GTP levels.
23155690 GnRHR mutations can be classified into partial or complete loss of function mutations. Partially inactivating substitutions of the GnRHR frequently found in familial hypogonadotrophic hypogonadism are Q106R and R262Q.
22788855 Reversal of hyogonadotropic hypogonadism and late-onset hypogonadism are reported in an untreated patient with a R262Q mutation of GNRHR.
22778172 Review of the role of GNRHR in neoplasms and as a treatment target. [Review Article]
22766261 Data suggest that mutations in GNRHR and TACR3 are the most common causative mutations in normosmic idiopathic hypogonadotropic hypogonadism in families in Turkey.
22745237 unidentified genetic and/or environmental factors may combine with singly mutated GNRHR alleles to produce reproductive phenotypes
22724017 Normosmic Congenital hypogonadotropic hypogonadism (HH)patients with a R262Q mutation in GHRHR accompanied by other GNRHR mutation may be prone to reversal of HH.
22710726 A potential role of GnRHR gene polymorphisms in the development of breast cancer.
22679506 Molecular deficiencies of the two novel GNRHR1 mutations lead to the CHH phenotype when present as a compound heterozygote.
22024993 molecular mechanisms involved in GnRH/GnRHR signaling at the maternal-fetal interface. {Review]
21832286 the TM4/ECL2 junction of GNRHR is crucial for peptide ligand binding and, consequently, for ligand-induced receptor conformational selection
21717411 Hypogonadotropic hypogonadism due to being homozygous for the G416A transition in the GNRHR gene. The parents were heterozygous mutation carriers.
21527534 Positioning of the long extracellular loop within the seven-alpha-helical bundle regulates GnRH receptor stability, proper trafficking, and function.
21330483 Data suggest that a subset of patients with primary aldosteronism has aberrant LHR and GNRHR expression, which could modulate aldosterone secretion.
21317933 P-cadherin cooperates with insulin-like growth factor-1 receptor to promote metastatic signaling of gonadotropin-releasing hormone in ovarian cancer via p120 catenin.
21277937 Thr104Ile and Tyr108Cys gonadotropin-releasing hormone receptors are misfolded structures whose function is rescuable by genetic and/or pharmacological strategies
21274726 The findings suggest novel pathophysiological links between the GNRHR locus and thyroid function and insulin secretion in polycystic ovary syndrome patients.
20836995 we discuss the composition and role of membrane rafts in cell signaling and examine evidence that the mammalian type I GnRHR is constitutively and exclusively localized to these membrane microdomains in various experimental model--REVIEW
20734064 Observational study of gene-disease association. (HuGE Navigator)
20670943 LH-RH receptor expression persisted despite prolonged exposure to LH-RH agonists in prostate cancer.
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20628612 Study conclude that the mammalian GnRH-RI is an intracellular GPCR that is expressed on the nuclear membrane.
20507982 analysis of Pulsatile and sustained gonadotropin-releasing hormone (GnRH) receptor signaling
20400076 The role of GnRH-GnRHR signaling at the maternal-fetal interface therefore appears to be limited to the regulation of trophoblast hCG production.
20236028 GnRHa may be an effective stimulator of local peritoneal fibrinolytic activity, as it decreases PAI-1 secretion in peritoneal Met5A cells by a mechanism linked to GnRHR.
20182875 Data show that among those GnRH receptor monoclonal antibodies, GHR-103, GHR-106 and GHR-114 exhibit high affinity and specificity to GnRH receptor as judged by the whole cell binding.
19858197 Pulsatile and sustained gonadotropin-releasing hormone (GnRH) receptor signaling: does the Ca2+/NFAT signaling pathway decode GnRH pulse frequency
19787259 Our findings support the merit of further investigation of the expression of LHRH-R-I and its transcript forms in human benign prostatic hyperplasia
19724914 Triple-negative breast cancers express receptors for luteinizing hormone-releasing hormone (LHRH) and respond to LHRH antagonist cetrorelix with growth inhibition.
19640273 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19489874 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19449676 We describe a patient with partial hypogonadotropic hypogonadism caused by a compound heterozygous GnRH-R mutation.
19372239 A ligand-dependent selective cross-communication between GnRH receptor and epidermal growth factor receptor signaling systems in human trophoblastic cell.
19246515 Novel information on the role of Lys191 in defining an optimal configuration for the hGnRHR intracellular trafficking and function.
19190109 the antitumor effect of gonadotropin-releasing hormone type i is mediated by the activation of type I (but not of type II) GnRH-R
19095769 Results reveal important pharmacophoric features of the GnRH receptor, and then identify a novel chemical ligand, able to rescue a D(98) mutant of the human GnRHR that could not be rescued as effectively by previously known pharmacoperones.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18980792 Data show that over half of meningiomas may be regulated by GnRH-GnRH-R expression in an autocrine fashion.
18682503 Observational study of gene-disease association. (HuGE Navigator)
18541137 Transient co-transfection of HEK293 cells with human WT GnRHR and with stimulatory and inhibitory G proteins led to either production or inhibition of total inositol phosphate production, depending on the G protein that was over-expressed
18463157 12% of Kallman syndrome males have KAL1 deletions, but intragenic deletions of the FGFR1, GNRH1, GNRHR, GPR54 and NELF genes are uncommon in Idiopathic hypogonadotropic hypogonadism/Kallman syndrome.
18356273 Two endogenous forms of GnRH ligand but only one functional form of full-length GnRH receptor in humans elecits specific functions of the receptor.
18252959 We have defined the proportion of GnRHRs at the cell surface.
17942747 Arg(38(1.35)) of the GnRH receptor is essential for high-affinity binding of GnRH agonists and stabilizing the receptor active conformation
17710733 Summarizes the overall structure-function relationships of the human GnRH receptor, with an emphasis on the impact of naturally occurring mutations.
17452338 These results reveal GnRH ligand and receptor structural elements for conformational selection, and support co-evolution of GnRH ligand and receptor conformations.
17179725 The R139C mutation almost completely abolished plasma membrane expression while having little effect on GnRH-binding affinity in hypogonadotropic hypoganadism-related mutant.
17170088 proportion of the human and the rat WT GnRHR appears to be retained in the endoplasmic reticulum by calnexin, an effect that decreases GnRHR signaling capacity
16968799 A homozygous R262Q mutation in the gonadotropin-releasing hormone receptor presenting as constitutional delay of growth and puberty with subsequent borderline oligospermia.
16613990 data suggest the occurrence of a specific LIM-HD pituitary code and designate the GnRH-R gene as the first identified transcriptional target of Isl-1 in the anterior pituitary
16364974 Activation of the GnRHR by interacting with GnRH may transcriptionally down-regulate itself via the protein kinase C pathway in human neuronal cells.
16359986 No mutations were identified in the male, whereas in the females the mutation Pro146Ser in the GnRHR was identified in heterozygosity in idiopathic hypogonadotropic hypogonadism
16322390 Observational study of gene-disease association. (HuGE Navigator)
16301116 Cryostat and paraffin sections of prostate biopsy samples of 10 untreated patients with prostate carcinoma (T2-T3, Gleason score 5-8) were investigated for Gn-RH receptors (Gn-RHR) and androgen receptors
16213849 Observational study of gene-disease association. (HuGE Navigator)
16213849 GNRHR mutations account for approximately 3.5% of all normosmic and 7%-11% of presumed autosomal recessive idiopathic hypogonadotropic hypogonadism, suggesting that additional genes play an important role in normal puberty.
15886197 there are species-specific dominant negative receptor trafficking effects of the GnRHR between human, rat and mouse
15761034 the GnRHR-II-reliquum plays a modulatory role in GnRHR-I expression
15563546 the HFRK motif in the membrane-proximal region confers the differential signal transduction pathways between mammalian and nonmammalian GnRHRs
15546906 Observational study of gene-disease association. (HuGE Navigator)
15546906 Genetic variation in GNRHR is not likely to be a substantial modulator of pubertal timing in the general population.
15529183 Expression of gonadotropin-releasing hormone receptor in endometrial stromal sarcomas may provide a rationale for a clinical study of gonadotropin-releasing hormone analogs in the treatment of women with endometrial stromal sarcomas.
15149726 Pro7.33(303) of the human GnRH receptor is required for selective high affinity binding of mammalian GnRH.
15105440 the dominant-negative effect, which occurs for human GnRHR mutants isolated from patients with hypogonadotropic hypogonadism , results from receptor retention in the endoplasmic reticulum by mislocalized mutants.
14726258 In hormone-related tumors, type I GnRH receptors are coupled to the Gi-cAMP signal transduction pathway. In melanoma cells, GnRH-I behaves as a negative regulator of tumor growth and progression.
14565958 Neurons express GnRH receptor and responded to GnRH with time- and dose-dependent increases in GnRH gene expression and protein release.
14551223 direct role for the GnRHR in mediating antiproliferative events in two cell systems, neither of which was derived from extrapituitary reproductive tumors.
12947046 Estrogen receptor-alpha represses human GnRH receptor gene transcription via an indirect mechanism involving Creb-binding protein.
12843188 The dominant-negative effect of the naturally occurring receptor mutants for the WT hGnRHR, which has intrinsic low maturation efficiency suggesting that this effect and the diminished plasma membrane expression is a recent evolutionary event.
12788881 Genetic analysis has excluded sequence variations in GNRH1 and GNRHR in four families with recessive IHH, suggesting the existence of a novel, as-yet-undiscovered gene for this condition.
12568864 A missense mutation in this gene is found in a case of complete hypogonadotropic hypogonadism.
12446597 results clearly indicate a role of octamer transcription factor-1 in the transcriptional repression of the human gonadotropin-releasing hormone receptor gene
12161512 Locally expressed LHRH receptors mediate the oncostatic and antimetastatic activity of LHRH agonists on melanoma cells.
12089350 our results strongly indicate a role of the C/EBP and GATA motifs in regulating GnRHR gene transcription in human granulosa-luteal cells
12054603 conserved physical linkage in medaka and human genomes
12050282 Novel homozygous splice acceptor site GnRH receptor (GnRHR) mutation: human GnRHR "knockout". amenorrhea and absent thelarche and pubarche
12040003 Coupling of GnRH concentration and the GnRH receptor-activated gene program
11994356 the E(90)K mutation impairs hGnRHR-effector coupling; sequence modifications that enhance surface expression of the receptor restore function
11981042 Site-directed mutagenesis of the C-terminal domain of extracellular loop 2 of the human GnRH receptor showed that a minimum of two mutations is needed in this region for agonist activity of antagonist 135-18
9272108 This paper reported that a total of 18 transcriptional start sites were identified for the GNRHR gene in the pituitary, which were different from those 5 transcriptional start sites identified in the brain by Fan et al (PMID7768323).
7768323 Reports complete structure of human gonadotropin-releasing hormone receptor gene with figure 2 showing multiple promoters, transcription sites, and polyadenylation signals.

AA Sequence

MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKG      1 - 70
KKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRS     71 - 140
LAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAF    141 - 210
YNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCW    211 - 280
TPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL                          281 - 328
//

Text Mined References (126)

PMID Year Title
26644469 2016 Information Transfer in Gonadotropin-releasing Hormone (GnRH) Signaling: EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK)-MEDIATED FEEDBACK LOOPS CONTROL HORMONE SENSING.
26308290 2015 GnRH Agonist Triggering Modulates PEDF to VEGF Ratio Inversely to hCG in Granulosa Cells.
26044071 2016 Gonadotropin-releasing hormone receptor mutations in ageing men.
25592315 2015 Severe gastrointestinal dysmotility developed after treatment with gonadotropin-releasing hormone analogs.
25531638 2015 Triallelic digenic mutation in the prokineticin 2 and GNRH receptor genes in two brothers with normosmic congenital hypogonadotropic hypogonadism.
25293576 2015 Receptors for luteinizing hormone-releasing hormone (GnRH) as therapeutic targets in triple negative breast cancers (TNBC).
25077900 2014 The prevalence of CHD7 missense versus truncating mutations is higher in patients with Kallmann syndrome than in typical CHARGE patients.
25016926 2014 Role of gonadotropin-releasing hormone receptor mutations in patients with a wide spectrum of pubertal delay.
24732674 2014 Genetics of congenital hypogonadotropic hypogonadism in Denmark.
24685158 2014 Quality control autophagy degrades soluble ERAD-resistant conformers of the misfolded membrane protein GnRHR.
24472523 2014 Aberrant gonadotropin-releasing hormone receptor (GnRHR) expression and its regulation of CYP11B2 expression and aldosterone production in adrenal aldosterone-producing adenoma (APA).
24002956 2013 [Multiplex ligation dependent probe amplification analysis of KAL1, GNRH1, GNRHR, PROK2 and PROKR2 in male patients with idiopathic hypogonadotropic hypogonadism].
23994024 2014 Outside the box signaling: secreted factors modulate GnRH receptor-mediated gonadotropin regulation.
23891857 2013 Species sequence differences determine the interaction of GnRH receptor with the cellular quality control system.
23643382 2013 Mutations in FGF17, IL17RD, DUSP6, SPRY4, and FLRT3 are identified in individuals with congenital hypogonadotropic hypogonadism.
23632635 2013 Reproductive physiology of a humanized GnRH receptor mouse model: application in evaluation of human-specific analogs.
23380421 2013 Differential signaling of the GnRH receptor in pituitary gonadotrope cell lines and prostate cancer cell lines.
23287110 2013 Gonadotropin-releasing hormone neuropeptides and receptor in human breast cancer: correlation to poor prognosis parameters.
23233674 2013 SET protein interacts with intracellular domains of the gonadotropin-releasing hormone receptor and differentially regulates receptor signaling to cAMP and calcium in gonadotrope cells.
23176180 2012 Gonadotropin-releasing hormone receptor activates GTPase RhoA and inhibits cell invasion in the breast cancer cell line MDA-MB-231.
23155690 2012 Molecular defects of the GnRH-receptor gene in Chinese patients with idiopathic hypogonadotropic hypogonadism and the severity of hypogonadism.
22788855 2013 A homozygous R262Q mutation in the gonadotropin-releasing hormone receptor presenting as reversal of hypogonadotropic hypogonadism and late-onset hypogonadism.
22778172 2012 GnRH receptors in cancer: from cell biology to novel targeted therapeutic strategies.
22766261 2012 Distribution of gene mutations associated with familial normosmic idiopathic hypogonadotropic hypogonadism.
22745237 2012 When genetic load does not correlate with phenotypic spectrum: lessons from the GnRH receptor (GNRHR).
22724017 2012 Reversible congenital hypogonadotropic hypogonadism in patients with CHD7, FGFR1 or GNRHR mutations.
22710726 2012 Single nucleotide polymorphisms in the regulatory region of gonadotropin-releasing hormone receptor gene and breast cancer susceptibility.
22679506 2012 Congenital hypogonadotropic hypogonadism due to GnRH receptor mutations in three brothers reveal sites affecting conformation and coupling.
22024993 2011 Gonadotropin-releasing hormone/gonadotropin-releasing hormone receptor signaling in the placenta.
21832286 2011 Role of the transmembrane domain 4/extracellular loop 2 junction of the human gonadotropin-releasing hormone receptor in ligand binding and receptor conformational selection.
21717411 2011 Hypogonadotropic hypogonadism due to GnRH receptor mutation in a sibling.
21527534 2011 Salt bridges overlapping the gonadotropin-releasing hormone receptor agonist binding site reveal a coincidence detector for G protein-coupled receptor activation.
21330483 2011 A case of primary aldosteronism in pregnancy: do LH and GNRH receptors have a potential role in regulating aldosterone secretion?
21317933 2011 P-cadherin cooperates with insulin-like growth factor-1 receptor to promote metastatic signaling of gonadotropin-releasing hormone in ovarian cancer via p120 catenin.
21277937 2011 Biochemical mechanism of pathogenesis of human gonadotropin-releasing hormone receptor mutants Thr104Ile and Tyr108Cys associated with familial hypogonadotropic hypogonadism.
21274726 2011 Common genetic variation in the 3'-untranslated region of gonadotropin-releasing hormone receptor regulates gene expression in cella and is associated with thyroid function, insulin secretion as well as insulin sensitivity in polycystic ovary syndrome patients.
20836995 2010 Membrane rafts and GnRH receptor signaling.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20670943 2010 Expression of receptors for luteinizing hormone-releasing hormone (LH-RH) in prostate cancers following therapy with LH-RH agonists.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20628612 2010 The human gonadotropin releasing hormone type I receptor is a functional intracellular GPCR expressed on the nuclear membrane.
20507982 2010 Pulsatile and sustained gonadotropin-releasing hormone (GnRH) receptor signaling: does the ERK signaling pathway decode GnRH pulse frequency?
20400076 2010 Role of GnRH-GnRH receptor signaling at the maternal-fetal interface.
20236028 2010 GnRH receptor and peritoneal plasmin activity.
20182875 2010 Growth inhibition of tumor cells in vitro by using monoclonal antibodies against gonadotropin-releasing hormone receptor.
19858197 2009 Pulsatile and sustained gonadotropin-releasing hormone (GnRH) receptor signaling: does the Ca2+/NFAT signaling pathway decode GnRH pulse frequency?
19787259 2009 Expression of mRNA for human type-I LHRH receptor transcript forms in human benign prostatic hyperplasia.
19724914 2009 Triple-negative breast cancers express receptors for luteinizing hormone-releasing hormone (LHRH) and respond to LHRH antagonist cetrorelix with growth inhibition.
19640273 2009 Genetic polymorphisms of the GNRH1 and GNRHR genes and risk of breast cancer in the National Cancer Institute Breast and Prostate Cancer Cohort Consortium (BPC3).
19489874 2010 Screening of autosomal gene deletions in patients with hypogonadotropic hypogonadism using multiplex ligation-dependent probe amplification: detection of a hemizygosis for the fibroblast growth factor receptor 1.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19449676 2009 Partial hypogonadotropic hypogonadism associated with the Leu266Arg and Gln106Arg mutation of the gonadotropin-releasing hormone receptor.
19372239 2009 Promotion of human trophoblasts invasion by gonadotropin-releasing hormone (GnRH) I and GnRH II via distinct signaling pathways.
19246515 2009 Conformational effects of Lys191 in the human GnRH receptor: mutagenesis and molecular dynamics simulations studies.
19190109 2009 Type I gonadotropin-releasing hormone receptor mediates the antiproliferative effects of GnRH-II on prostate cancer cells.
19095769 2009 Molecular mechanism of action of pharmacoperone rescue of misrouted GPCR mutants: the GnRH receptor.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18980792 2009 Gonadotropin-releasing hormone (GnRH) and its receptor in human meningiomas.
18682503 2008 Loss-of-function mutations in the genes encoding prokineticin-2 or prokineticin receptor-2 cause autosomal recessive Kallmann syndrome.
18541137 2008 Multiple G proteins compete for binding with the human gonadotropin releasing hormone receptor.
18463157 2008 The prevalence of intragenic deletions in patients with idiopathic hypogonadotropic hypogonadism and Kallmann syndrome.
18356273 2008 Changes to gonadotropin-releasing hormone (GnRH) receptor extracellular loops differentially affect GnRH analog binding and activation: evidence for distinct ligand-stabilized receptor conformations.
18252959 2008 Plasma membrane expression of GnRH receptors: regulation by antagonists in breast, prostate, and gonadotrope cell lines.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17942747 2008 Identification of a novel ligand binding residue Arg38(1.35) in the human gonadotropin-releasing hormone receptor.
17710733 2007 Mutations in the human gonadotropin-releasing hormone receptor: insights into receptor biology and function.
17452338 2007 Structural determinants for ligand-receptor conformational selection in a peptide G protein-coupled receptor.
17179725 2006 Molecular genetic analysis of normosmic hypogonadotropic hypogonadism in a Turkish population: identification and detailed functional characterization of a novel mutation in the gonadotropin-releasing hormone receptor gene.
17170088 2006 Calnexin regulated gonadotropin-releasing hormone receptor plasma membrane expression.
16968799 2006 A homozygous R262Q mutation in the gonadotropin-releasing hormone receptor presenting as constitutional delay of growth and puberty with subsequent borderline oligospermia.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16613990 2006 The LIM-homeodomain proteins Isl-1 and Lhx3 act with steroidogenic factor 1 to enhance gonadotrope-specific activity of the gonadotropin-releasing hormone receptor gene promoter.
16364974 2005 Expression and transcriptional regulation of the GnRH receptor gene in human neuronal cells.
16359986 2005 The gonadotropin-releasing hormone (GnRH)-1 gene, the GnRH receptor gene, and their promoters in patients with idiopathic hypogonadotropic hypogonadism with or without resistance to GnRH action.
16322390 2005 Role of sequence variations of the GnRH receptor and G protein-coupled receptor 54 gene in male idiopathic hypogonadotropic hypogonadism.
16301116 Immunohistochemical demonstration of gonadotropin-releasing hormone receptors in prostate carcinoma.
16213849 2005 The prevalence of gonadotropin-releasing hormone receptor mutations in a large cohort of patients with hypogonadotropic hypogonadism.
15886197 2005 Parallel regulation of membrane trafficking and dominant-negative effects by misrouted gonadotropin-releasing hormone receptor mutants.
15761034 2005 Inhibition of human type i gonadotropin-releasing hormone receptor (GnRHR) function by expression of a human type II GnRHR gene fragment.
15563546 2005 Membrane-proximal region of the carboxyl terminus of the gonadotropin-releasing hormone receptor (GnRHR) confers differential signal transduction between mammalian and nonmammalian GnRHRs.
15546906 2005 Determination of sequence variation and haplotype structure for the gonadotropin-releasing hormone (GnRH) and GnRH receptor genes: investigation of role in pubertal timing.
15529183 2005 Gonadotropin-releasing hormone receptor expression in endometrial stromal sarcomas: an immunohistochemical study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15149726 2004 Pro7.33(303) of the human GnRH receptor regulates selective binding of mammalian GnRH.
15105440 2004 Human loss-of-function gonadotropin-releasing hormone receptor mutants retain wild-type receptors in the endoplasmic reticulum: molecular basis of the dominant-negative effect.
14726258 2003 The biology of gonadotropin hormone-releasing hormone: role in the control of tumor growth and progression in humans.
14565958 2004 Expression and function of gonadotropin-releasing hormone (GnRH) receptor in human olfactory GnRH-secreting neurons: an autocrine GnRH loop underlies neuronal migration.
14551223 2004 Gonadotropin-releasing hormone receptor-mediated growth suppression of immortalized LbetaT2 gonadotrope and stable HEK293 cell lines.
12947046 2003 An activator protein 1-like motif mediates 17beta-estradiol repression of gonadotropin-releasing hormone receptor promoter via an estrogen receptor alpha-dependent mechanism in ovarian and breast cancer cells.
12843188 2003 Dominant-negative action of disease-causing gonadotropin-releasing hormone receptor (GnRHR) mutants: a trait that potentially coevolved with decreased plasma membrane expression of GnRHR in humans.
12788881 2003 Autosomal recessive idiopathic hypogonadotropic hypogonadism: genetic analysis excludes mutations in the gonadotropin-releasing hormone (GnRH) and GnRH receptor genes.
12679486 2003 Mutation Ala(171)Thr stabilizes the gonadotropin-releasing hormone receptor in its inactive conformation, causing familial hypogonadotropic hypogonadism.
12568864 2003 A case of complete hypogonadotropic hypogonadism with a mutation in the gonadotropin-releasing hormone receptor gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446597 2002 Oct-1 is involved in the transcriptional repression of the gonadotropin-releasing hormone receptor gene.
12161512 2002 Locally expressed LHRH receptors mediate the oncostatic and antimetastatic activity of LHRH agonists on melanoma cells.
12089350 2002 Characterization of a new upstream GnRH receptor promoter in human ovarian granulosa-luteal cells.
12062898 2002 Regulation of the gonadotropin-releasing hormone receptor (GnRHR) by RGS proteins: role of the GnRHR carboxyl-terminus.
12054603 2002 Conserved physical linkage of GnRH-R and RBM8 in the medaka and human genomes.
12040003 2002 Coupling of GnRH concentration and the GnRH receptor-activated gene program.
11997175 2002 Conserved mammalian gonadotropin-releasing hormone receptor carboxyl terminal amino acids regulate ligand binding, effector coupling and internalization.
11994356 2002 Molecular basis of hypogonadotropic hypogonadism: restoration of mutant (E(90)K) GnRH receptor function by a deletion at a distant site.
11981042 2002 Two mutations in extracellular loop 2 of the human GnRH receptor convert an antagonist to an agonist.
11397871 2001 Two novel mutations in the gonadotropin-releasing hormone receptor gene in Brazilian patients with hypogonadotropic hypogonadism and normal olfaction.
11397842 2001 The fertile eunuch variant of idiopathic hypogonadotropic hypogonadism: spontaneous reversal associated with a homozygous mutation in the gonadotropin-releasing hormone receptor.
11318785 2001 A novel homozygous mutation in the second transmembrane domain of the gonadotrophin releasing hormone receptor gene.
11278883 2001 Constitutive and agonist-dependent homo-oligomerization of the thyrotropin-releasing hormone receptor. Detection in living cells using bioluminescence resonance energy transfer.
10999776 2000 A new compound heterozygous mutation of the gonadotropin-releasing hormone receptor (L314X, Q106R) in a woman with complete hypogonadotropic hypogonadism: chronic estrogen administration amplifies the gonadotropin defect.
10686191 2000 Ovarian stimulation with HMG: results of a prospective randomized phase III European study comparing the luteinizing hormone-releasing hormone (LHRH)-antagonist cetrorelix and the LHRH-agonist buserelin. European Cetrorelix Study Group.
10523035 1999 Complete hypogonadotropic hypogonadism associated with a novel inactivating mutation of the gonadotropin-releasing hormone receptor.
10366411 1999 Tissue-specific pattern of variant transcripts of the human gonadotropin-releasing hormone receptor gene.
10084584 1999 Resistance of hypogonadic patients with mutated GnRH receptor genes to pulsatile GnRH administration.
10022417 1999 The same molecular defects of the gonadotropin-releasing hormone receptor determine a variable degree of hypogonadism in affected kindred.
9425890 1998 Mutations in gonadotropin-releasing hormone receptor gene cause hypogonadotropic hypogonadism.
9414473 1997 Advances in understanding gonadotrophin-releasing hormone receptor structure and ligand interactions.
9371856 1997 A family with hypogonadotropic hypogonadism and mutations in the gonadotropin-releasing hormone receptor.
9272108 1997 Molecular structure of the human gonadotropin-releasing hormone receptor gene.
9259321 1997 Inhibition of gonadotropin-releasing hormone receptor signaling by expression of a splice variant of the human receptor.
8472841 1993 Follistatins: more than follicle-stimulating hormone suppressing proteins.
8386108 1993 Cloning and characterization of the human GnRH receptor.
7958384 1994 The human gonadotropin-releasing hormone (GnRH) receptor gene: cloning, genomic organization and chromosomal assignment.
7768323 1995 The human gonadotropin-releasing hormone receptor gene: complete structure including multiple promoters, transcription initiation sites, and polyadenylation signals.
7613048 1995 Mapping of the gonadotropin-releasing hormone (GnRH) receptor gene to human chromosome 4q21.2 by fluorescence in situ hybridization.
7534732 1994 The nucleotide sequences of human GnRH receptors in breast and ovarian tumors are identical with that found in pituitary.
1333190 1992 Cloning, sequencing, and expression of human gonadotropin releasing hormone (GnRH) receptor.