Property Summary

Ligand Count 760
NCBI Gene PubMed Count 128
PubMed Score 444.85
PubTator Score 603.81

Knowledge Summary

Patent (13,868)

TINX Plot

  Disease (8)

Disease Target Count P-value
psoriasis 6694 5.2e-19
medulloblastoma, large-cell 6241 3.3e-03
pituitary cancer 1972 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Klinefelter's syndrome 56 0.0 4.0

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.500 3.3e-03
pituitary cancer -2.400 1.1e-02
psoriasis 2.000 5.2e-19

Protein-protein Interaction (1)

Gene RIF (103)

AA Sequence

MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKG      1 - 70
KKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRS     71 - 140
LAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAF    141 - 210
YNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCW    211 - 280
TPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL                          281 - 328
//

Text Mined References (129)

PMID Year Title