Property Summary

NCBI Gene PubMed Count 29
PubMed Score 19.15
PubTator Score 21.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma -1.300 3.2e-05
medulloblastoma, large-cell -1.200 6.6e-05
osteosarcoma -1.319 4.9e-04
ovarian cancer -1.200 2.1e-07

Gene RIF (15)

AA Sequence

MAAGLARLLLLLGLSAGGPAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGK      1 - 70
CFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVEL     71 - 140
ACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLR    141 - 210
TLFEDAGYLKTPEENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLE    211 - 280
HLGHETPRAKSPEQLRGDPGLRGSL                                                 281 - 305
//

Text Mined References (33)

PMID Year Title