Property Summary

NCBI Gene PubMed Count 50
PubMed Score 147.14
PubTator Score 76.81

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.600 2.5e-03
astrocytic glioma -1.500 2.6e-02
Astrocytoma, Pilocytic 1.200 2.1e-03
atypical teratoid / rhabdoid tumor -1.400 5.5e-03
Chronic Lymphocytic Leukemia 1.362 1.2e-02
colon cancer -1.100 3.9e-02
ependymoma -1.400 6.0e-08
glioblastoma -1.300 1.1e-05
group 4 medulloblastoma -1.400 8.0e-03
intraductal papillary-mucinous adenoma (... 1.400 2.7e-02
invasive ductal carcinoma 1.177 2.7e-03
malignant mesothelioma -2.400 2.0e-07
medulloblastoma, large-cell -2.000 1.8e-04
oligodendroglioma -1.600 2.8e-02
ovarian cancer 2.700 1.7e-05
primitive neuroectodermal tumor -1.900 1.3e-03
psoriasis -1.200 7.8e-08
Rheumatoid arthritis 1.100 3.1e-02
subependymal giant cell astrocytoma 1.406 3.3e-02

 GWAS Trait (1)

Gene RIF (35)

AA Sequence

MLFKLLQRQTYTCLSHRYGLYVCFLGVVVTIVSAFQFGEVVLEWSRDQYHVLFDSYRDNIAGKSFQNRLC      1 - 70
LPMPIDVVYTWVNGTDLELLKELQQVREQMEEEQKAMREILGKNTTEPTKKSEKQLECLLTHCIKVPMLV     71 - 140
LDPALPANITLKDLPSLYPSFHSASDIFNVAKPKNPSTNVSVVVFDSTKDVEDAHSGLLKGNSRQTVWRG    141 - 210
YLTTDKEVPGLVLMQDLAFLSGFPPTFKETNQLKTKLPENLSSKVKLLQLYSEASVALLKLNNPKDFQEL    211 - 280
NKQTKKNMTIDGKELTISPAYLLWDLSAISQSKQDEDISASRFEDNEELRYSLRSIERHAPWVRNIFIVT    281 - 350
NGQIPSWLNLDNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDF    351 - 420
YSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSGNSGGSRYIAGGGGTGSIGVG    421 - 490
QPWQFGGGINSVSYCNQGCANSWLADKFCDQACNVLSCGFDAGDCGQDHFHELYKVILLPNQTHYIIPKG    491 - 560
ECLPYFSFAEVAKRGVEGAYSDNPIIRHASIANKWKTIHLIMHSGMNATTIHFNLTFQNTNDEEFKMQIT    561 - 630
VEVDTREGPKLNSTAQKGYENLVSPITLLPEAEILFEDIPKEKRFPKFKRHDVNSTRRAQEEVKIPLVNI    631 - 700
SLLPKDAQLSLNTLDLQLEHGDITLKGYNLSKSALLRSFLMNSQHAKIKNQAIITDETNDSLVAPQEKQV    701 - 770
HKSILPNSLGVSERLQRLTFPAVSVKVNGHDQGQNPPLDLETTARFRVETHTQKTIGGNVTKEKPPSLIV    771 - 840
PLESQMTKEKKITGKEKENSRMEENAENHIGVTEVLLGRKLQHYTDSYLGFLPWEKKKYFQDLLDEEESL    841 - 910
KTQLAYFTDSKNTGRQLKDTFADSLRYVNKILNSKFGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFDKT    911 - 980
SFHKVRHSEDMQFAFSYFYYLMSAVQPLNISQVFDEVDTDQSGVLSDREIRTLATRIHELPLSLQDLTGL    981 - 1050
EHMLINCSKMLPADITQLNNIPPTQESYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDKNKYRFEIMGEEE   1051 - 1120
IAFKMIRTNVSHVVGQLDDIRKNPRKFVCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQFELPREYRN   1121 - 1190
RFLHMHELQEWRAYRDKLKFWTHCVLATLIMFTIFSFFAEQLIALKRKIFPRRRIHKEASPNRIRV       1191 - 1256
//

Text Mined References (54)

PMID Year Title