Property Summary

NCBI Gene PubMed Count 49
PubMed Score 18.55
PubTator Score 24.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.050 8.1e-03
lung carcinoma 1.100 2.4e-09
ovarian cancer -1.600 6.4e-09
pancreatic cancer 1.100 1.2e-02

Gene RIF (18)

PMID Text
20843981 Observational study of gene-disease association. (HuGE Navigator)
20816195 Observational study of gene-disease association. (HuGE Navigator)
20816152 Observational study of gene-disease association. (HuGE Navigator)
20725061 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20724581 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20520848 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20215397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19910938 Observational study of gene-disease association. (HuGE Navigator)
19910641 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19851340 Data show that SNPs in SEC16B and TMEM18 were significantly associated with obesity, and the SNPs in GNPDA2, BDNF, FAIM2 and MC4R were marginally associated with obesity in Japanese.
19851340 Observational study of gene-disease association. (HuGE Navigator)
19812171 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19746409 Observational study of gene-disease association. (HuGE Navigator)
19692490 Observational study of gene-disease association. (HuGE Navigator)
19164386 Observational study of gene-disease association. (HuGE Navigator)
19079261 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFN      1 - 70
MDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGP     71 - 140
DGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMDAREVMILITGAHKAF    141 - 210
ALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN        211 - 276
//

Text Mined References (53)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
23669352 2013 Genome-wide analysis of BMI in adolescents and young adults reveals additional insight into the effects of genetic loci over the life course.
23583978 2013 A meta-analysis identifies new loci associated with body mass index in individuals of African ancestry.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
22710927 2013 Genetic susceptibility, birth weight and obesity risk in young Chinese.
22511254 2012 Susceptibility variants for obesity and colorectal cancer risk: the multiethnic cohort and PAGE studies.
22456663 2012 Adult obesity susceptibility variants are associated with greater childhood weight gain and a faster tempo of growth: the 1946 British Birth Cohort Study.
22344219 2012 Meta-analysis identifies common variants associated with body mass index in east Asians.
22179955 2012 Genetic predictors of weight loss and weight regain after intensive lifestyle modification, metformin treatment, or standard care in the Diabetes Prevention Program.
22083549 2012 Study of eight GWAS-identified common variants for association with obesity-related indices in Chinese children at puberty.
22029802 2011 Genetic risk score does not correlate with body mass index of Latina women in a clinical trial.
21935397 2011 Genome-wide population-based association study of extremely overweight young adults--the GOYA study.
21912638 2011 Studies of metabolic phenotypic correlates of 15 obesity associated gene variants.
21796141 2011 Computed tomography analysis of the association between the SH2B1 rs7498665 single-nucleotide polymorphism and visceral fat area.
21796137 2011 Association of variations in the FTO, SCG3 and MTMR9 genes with metabolic syndrome in a Japanese population.
21779088 2011 Role of BMI-associated loci identified in GWAS meta-analyses in the context of common childhood obesity in European Americans.
21773002 2011 Mendelian Randomisation Study of Childhood BMI and Early Menarche.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21593506 2011 Maternal and offspring adiposity-related genetic variants and gestational weight gain.
21544081 2012 Replication of 13 obesity loci among Singaporean Chinese, Malay and Asian-Indian populations.
21369819 2011 Association of genetic variants for susceptibility to obesity with type 2 diabetes in Japanese individuals.
21248185 2011 Obesity-susceptibility loci have a limited influence on birth weight: a meta-analysis of up to 28,219 individuals.
21147891 2011 Genetic variants associated with persistent central obesity and the metabolic syndrome in a 12-year longitudinal study.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20843981 2010 Associations of six single nucleotide polymorphisms in obesity-related genes with BMI and risk of obesity in Chinese children.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20816152 2010 Obesity and diabetes genetic variants associated with gestational weight gain.
20725061 2011 MC4R variant is associated with BMI but not response to resistance training in young females.
20724581 2010 Genetic susceptibility to obesity and related traits in childhood and adolescence: influence of loci identified by genome-wide association studies.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20520848 2010 Genetic markers of adult obesity risk are associated with greater early infancy weight gain and growth.
20215397 2010 Implication of genetic variants near NEGR1, SEC16B, TMEM18, ETV5/DGKG, GNPDA2, LIN7C/BDNF, MTCH2, BCDIN3D/FAIM2, SH2B1, FTO, MC4R, and KCTD15 with obesity and type 2 diabetes in 7705 Chinese.
19910938 2010 Novel obesity risk loci do not determine distribution of body fat depots: a whole-body MRI/MRS study.
19910641 2010 Obesity genotype score and cardiovascular risk in women with type 2 diabetes mellitus.
19851340 2009 Association between obesity and polymorphisms in SEC16B, TMEM18, GNPDA2, BDNF, FAIM2 and MC4R in a Japanese population.
19812171 2010 Cumulative effects and predictive value of common obesity-susceptibility variants identified by genome-wide association studies.
19746409 2010 Are recently identified genetic variants regulating BMI in the general population associated with anorexia nervosa?
19692490 2009 Obesity genes identified in genome-wide association studies are associated with adiposity measures and potentially with nutrient-specific food preference.
19164386 2009 Replication and extension of genome-wide association study results for obesity in 4923 adults from northern Sweden.
19079261 2009 Six new loci associated with body mass index highlight a neuronal influence on body weight regulation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12965206 2003 Two mammalian glucosamine-6-phosphate deaminases: a structural and genetic study.
12616532 2003 Cloning and functional characterization of GNPI2, a novel human homolog of glucosamine-6-phosphate isomerase/oscillin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.