Property Summary

NCBI Gene PubMed Count 78
PubMed Score 91.23
PubTator Score 93.19

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
non diabetic and post-ischemic heart fai... -1.100 7.8e-03
medulloblastoma, large-cell 1.200 7.2e-04
acute quadriplegic myopathy 1.139 4.4e-05
lung cancer 2.200 1.0e-05
colon cancer 1.300 4.0e-07
spina bifida -1.027 4.3e-02
Pick disease -1.300 2.4e-05
progressive supranuclear palsy -1.200 6.4e-03
ovarian cancer 2.500 1.2e-05
dermatomyositis 1.200 7.0e-04

Gene RIF (53)

PMID Text
26722529 The expression level of GNL3 was examined in 89 human gastric cancer samples using immunohistochemistry (IHC) staining. GNL3 in gastric cancer tissues was significantly upregulated compared with paracancerous tissues.
26517370 Study demonstrated overexpression of NS in most hepatocellular carcinoma tissues compared with their matched surrounding tissues, and silencing NS promoted UV- and serum starvation-induced apoptosis of MHCC97H and Bel7402 cells.
26429724 over-expression of GNL3 and SKA3 in the PC-3 human prostate cancer cell line decreased in vitro cell migration and invasion
25699361 Silence of nucleostemin inhibit cell proliferation through up-regulating p21 expression and nucleostemin may be involved in the pathogenesis of esophageal squamous cell carcinoma.
25347121 p53 activation by inauhzin via inhibiting SIRT1, also inhibits cellular IMPDH2 activity, reduces the levels of cellular GTP and GTP-binding nucleostemin, thus representing in a new anti-cancer strategy.
24960197 Gene expression profiling analysis revealed that cell cycle regulators and nucleotide metabolism-related genes were highly enriched in a gene set associated with leukaemia-initiating capacity that we termed the 'leukaemia stem cell gene signature'.
24886551 cis-acting regulatory polymorphisms acting on GNL3 and SPCS1 contribute to the OA association signal at chromosome 3p21, and these genes therefore merit further investigation.
24769896 overexpression of NS suppressed ARF polyubiquitination by its E3 ligase Ubiquitin Ligase for ARF and elongated its half-life, whereas knockdown of NS led to the decrease of ARF levels
24763828 Based on our results, NS overexpression seems to have a causative role in gastric tumorigenesis and/or progression, and it could be considered as a potential tumor marker for diagnosis, molecular classification
24762489 It is concluded that nucleostemin expression could not be specific in a certain type of cells in colon cancer cell line HT29.
24650343 Data shows that the NS protein expression status was positively correlated with both ER and HER2 status and was a powerful prognostic factor.
24119536 Nucleostemin can be used for tracking minimal residual disease and is a helpful guide for treatment.
22944692 Positional proteomics analysis identifies the cleavage of human guanine nucleotide binding protein-like 3 (GNL3) at amino acid residues 509-510 by the HIV-1 protease
22641345 The nucleostemin(NS)could promote the recruitment of PML-IV to SUMOylated TRF1 in TA( ) and ALT cells.
22318725 NS undergoes a ubiquitin- and MDM2-independent proteasomal degradation when intracellular GTP levels are markedly reduced
22174890 Nucleostemin is expressed in Glioblastoma-cancer stem cells isolated from patient samples, and that its expression, conversely to what it has been described for ordinary stem cells, does not disappear when cells are differentiated.
22081066 NS functions downstream of Myc as a rate-limiting regulator of cell proliferation and transformation.
22050045 nucleostemin expression level correlated with TWIST expression level in esophageal cancer cell lines; identified that high nucleostemin proportion, TWIST intensity, and advanced pathological N stage were correlated with poor relapse-free survival
22045740 NS inhibits TRF1 dimerization and shortens TRF1 association with the telomere.
21892090 expression in ovarian tumors closely correlated with origination, progression, and grading
21730156 a complex composed of TERT, BRG1, and NS/GNL3L maintains the function of tumor initiating cells
21655359 Telomere length in Sjogren syndrome is shorter and associated with lower levels of expression of p63 and nucleostemin than in non-Sjogren syndrome.
21443540 NS is widely expressed in normal and neoplastic oral epithelial tissues, and is likely a marker of proliferation
21242306 Reactive oxygen species regulate nucleostemin oligomerization and protein degradation.
21045149 Data show that knockdown of NS dramatically reduced the sphere-forming activity of MCF7 and MDA-MB-231 breast cancer cells.
20664182 Nucleostemin is an important G1/S checkpoint regulator and it could regulate cell cycles via a p53-independent pathway in prostate cancer.
20572164 Differential expression of NS, a stem cell marker, and its variants in different types of brain tumor are reported.
20021940 NS may promote the progression of prostate cancer by inhibiting the expression of p15, p16, and p18 in PC-3 cells.
19823871 The upregulation of nucleostemin ,mRNA frequently occurs in ESCC tissues and is associated with malignancy of human esophageal squamous tumors. nucleostemin is required for EGF and EGFR expression.
19706044 data indicate that nucleostemin expression is necessary for cell proliferation and evasion of apoptosis in bladder cancer cells, independent of its effect on p53
19648109 Studies demonstrate that NS plays an important role to maintain nucleolar structure and function on a more fundamental level than previously thought.
19416921 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19379559 Apoptosis of HL-60 leukemia cells can be induced by silencing NS gene expression.
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19106111 a novel role of nucleostemin in ribosome biogenesis.
19033382 nucleoplasmic relocation of nucleostemin during nucleolar disassembly safeguards the G2-M transit and survival of continuously dividing cells by MDM2 stabilization and p53 inhibition.
18646696 Nucleostemin mRNA and protein are over-expressed in human esophageal squamous cell carcinoma.
18519946 Nucleostemin expression in cardiomyocytes is induced by fibroblast growth factor-2 and accumulates in response to Pim-1 kinase activity.
18448670 Nucleophosmin is a binding partner of nucleostemin in human osteosarcoma cells
18426907 These results suggest that a p53-dependent cell cycle checkpoint monitors changes of cellular NS levels via the impediment of MDM2 function.
18419830 may be involved in carcinogenesis of the cervix and progression of cervical carcinoma
17494866 These results demonstrate that, in the cells investigated, the level of NS is regulated by p14(ARF) and the control of the G1/S transition by NS operates in a p53-dependent manner.
17310849 A general view of the NS-target genes indicates the possible pathways in which NS plays its role in proliferation control in Hela cells
17000763 Transgenic overexpression of nucleostemin increases the population doubling and decreases the senescence of mouse embryonic fibroblasts.
17000083 In cultured cells, nucleostemin is expressed in a distinct population of epidermal cells from hair follicle kept in the presence of a feeder layer, intimating an association of nucleostemin expression with this type of epithelio-mesenchymal interaction
16670719 Expression widely occurs in normal and malignant renal tissues, and is likely a proliferation marker rather than a unique regulator of cell proliferation and survival in stem and cancer cells.
16282439 Using a multipotential adherent population of stem cells, nucleostemin was localized to the nucleoli and occurred in 43.3% of the cells.
16097049 Transfected protein interacts with several proteins in COS cells.
16012751 Results implied that nucleostemin may play an important role in both tumorigenesis and transforming human embryonic bone marrow mesenchymal stem cells into F6 tumor cells.
15857956 analysis of nucleolar localization of stem cell protein nucleostemin
15657390 The nucleolar residence of nucleostemin involves a transient and a long-term binding by the basic and GTP-binding domains, and a dissociation mechanism mediated by the COOH-terminal region.
15595646 nucleostemin has a role in proliferation and tumorigenesis of HeLa cells
15112336 Data suggest that nucleostemin can help regulate the proliferation of both cancer cells and stem cells, and may play an important role in the growth regulation of gastric cancer, liver cancer and other cancers.

AA Sequence

MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLREAELRKQR      1 - 70
LEELKQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEA     71 - 140
SDVVLEVLDARDPLGCRCPQVEEAIVQSGQKKLVLILNKSDLVPKENLESWLNYLKKELPTVVFRASTKP    141 - 210
KDKGKITKRVKAKKNAAPFRSEVCFGKEGLWKLLGGFQETCSKAIRVGVIGFPNVGKSSIINSLKQEQMC    211 - 280
NVGVSMGLTRSMQVVPLDKQITIIDSPSFIVSPLNSSSALALRSPASIEVVKPMEAASAILSQADARQVV    281 - 350
LKYTVPGYRNSLEFFTVLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIV    351 - 420
VDMKSGFNLEELEKNNAQSIRAIKGPHLANSILFQSSGLTNGIIEEKDIHEELPKRKERKQEEREDDKDS    421 - 490
DQETVDEEVDENSSGMFAAEETGEALSEETTAGEQSTRSFILDKIIEEDDAYDFSTDYV               491 - 549
//

Text Mined References (85)

PMID Year Title
26722529 2015 Guanine nucleotide binding protein-like 3 is a potential prognosis indicator of gastric cancer.
26517370 2015 Nucleostemin Knockdown Sensitizes Hepatocellular Carcinoma Cells to Ultraviolet and Serum Starvation-Induced Apoptosis.
26429724 2015 GNL3 and SKA3 are novel prostate cancer metastasis susceptibility genes.
25699361 Knockdown of nucleostemin can inhibit the proliferation of esophageal carcinoma cells in vitro through upregulating p21.
25569094 2015 Telomerase reverse transcriptase regulates microRNAs.
25347121 2014 The role of IMP dehydrogenase 2 in Inauhzin-induced ribosomal stress.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24960197 2014 Association of a murine leukaemia stem cell gene signature based on nucleostemin promoter activity with prognosis of acute myeloid leukaemia in patients.
24886551 2014 Allelic expression analysis of the osteoarthritis susceptibility locus that maps to chromosome 3p21 reveals cis-acting eQTLs at GNL3 and SPCS1.
24769896 2015 Nucleostemin stabilizes ARF by inhibiting the ubiquitin ligase ULF.
24763828 2014 Concomitant upregulation of nucleostemin and downregulation of Sox2 and Klf4 in gastric adenocarcinoma.
24762489 Comparison of nucleostemin gene expression in CD133+ and CD133- cell population in colon cancer cell line HT29.
24650343 2014 Nucleostemin expression in invasive breast cancer.
24550003 2014 Involvement of telomerase reverse transcriptase in heterochromatin maintenance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24119536 2013 Transcript level of nucleostemin in newly diagnosed acute myeloid leukemia patients.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23092984 2012 Genome-wide association of mood-incongruent psychotic bipolar disorder.
22763110 2012 Identification of new susceptibility loci for osteoarthritis (arcOGEN): a genome-wide association study.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22641345 2012 Nucleostemin prevents telomere damage by promoting PML-IV recruitment to SUMOylated TRF1.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
22318725 2012 Ubiquitin- and MDM2 E3 ligase-independent proteasomal turnover of nucleostemin in response to GTP depletion.
22174890 2011 An off-target nucleostemin RNAi inhibits growth in human glioblastoma-derived cancer stem cells.
22081066 2012 Suppression of Myc oncogenic activity by nucleostemin haploinsufficiency.
22050045 2012 Nucleostemin and TWIST as predictive markers for recurrence after neoadjuvant chemotherapy for esophageal carcinoma.
22045740 2011 Nucleostemin inhibits TRF1 dimerization and shortens its dynamic association with the telomere.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21892090 2011 Clinical significance of nucleostemin expression and its correlation with cyclin D1 expression in malignant ovarian tumors.
21730156 2011 Maintenance of tumor initiating cells of defined genetic composition by nucleostemin.
21655359 2011 Comparison of telomere length and association with progenitor cell markers in lacrimal gland between Sjögren syndrome and non-Sjögren syndrome dry eye patients.
21443540 2011 Nucleostemin affects the proliferation but not differentiation of oral squamous cell carcinoma cells.
21269460 2011 Initial characterization of the human central proteome.
21242306 2011 Reactive oxygen species regulate nucleostemin oligomerization and protein degradation.
21132010 2011 GNL3L depletion destabilizes MDM2 and induces p53-dependent G2/M arrest.
21045149 2010 Tumor-initiating function of nucleostemin-enriched mammary tumor cells.
20664182 2010 Downregulation of nucleostemin causes G1 cell cycle arrest via a p53-independent pathway in prostate cancer PC-3 cells.
20572164 2010 Differential expression of nucleostemin, a stem cell marker, and its variants in different types of brain tumors.
20021940 2009 [Gene profiling after knocking-down the expression of NS gene in prostate cancer PC-3 cells].
19946888 2010 Defining the membrane proteome of NK cells.
19823871 2010 Expression of nucleostemin, epidermal growth factor and epidermal growth factor receptor in human esophageal squamous cell carcinoma tissues.
19706044 2009 Differential effects of Nucleostemin suppression on cell cycle arrest and apoptosis in the bladder cancer cell lines 5637 and SW1710.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19648109 2009 Novel role of nucleostemin in the maintenance of nucleolar architecture and integrity of small nucleolar ribonucleoproteins and the telomerase complex.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19487455 2009 GNL3L stabilizes the TRF1 complex and promotes mitotic transition.
19416921 2009 Genome-wide association and meta-analysis of bipolar disorder in individuals of European ancestry.
19379559 2009 [Effects of silent nucleostemin gene expression on apoptosis of HL-60 cells in vitro].
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19106111 2009 Critical role of nucleostemin in pre-rRNA processing.
19033382 2008 Nucleoplasmic mobilization of nucleostemin stabilizes MDM2 and promotes G2-M progression and cell survival.
18646696 2008 [Expression of nucleostemin mRNA and protein in the esophageal squamous cell carcinoma].
18519946 2008 Myocardial induction of nucleostemin in response to postnatal growth and pathological challenge.
18448670 2008 Nucleophosmin is a binding partner of nucleostemin in human osteosarcoma cells.
18426907 2008 Aberrant expression of nucleostemin activates p53 and induces cell cycle arrest via inhibition of MDM2.
18419830 2008 Stem-cell-abundant proteins Nanog, Nucleostemin and Musashi1 are highly expressed in malignant cervical epithelial cells.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
17494866 2007 Depletion of the nucleolar protein nucleostemin causes G1 cell cycle arrest via the p53 pathway.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17310849 2006 Gene profiling after knocking-down expression of nucleostemin in Hela cells using oligonucleotide DNA microarray.
17000763 2006 Nucleostemin delays cellular senescence and negatively regulates TRF1 protein stability.
17000083 2006 Immunocyto- and histochemical profiling of nucleostemin expression: marker of epidermal stem cells?
16670719 2006 Nucleostemin mRNA is expressed in both normal and malignant renal tissues.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16282439 2006 Nucleostemin is a marker of proliferating stromal stem cells in adult human bone marrow.
16097049 2005 Screening and identification of proteins interacting with nucleostemin.
16012751 2005 Cloning of the nucleostemin gene and its function in transforming human embryonic bone marrow mesenchymal stem cells into F6 tumor cells.
15857956 2005 A nonribosomal landscape in the nucleolus revealed by the stem cell protein nucleostemin.
15657390 2005 A multistep, GTP-driven mechanism controlling the dynamic cycling of nucleostemin.
15595646 2004 The effect of knocking-down nucleostemin gene expression on the in vitro proliferation and in vivo tumorigenesis of HeLa cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15112336 2004 Role of nucleostemin in growth regulation of gastric cancer, liver cancer and other malignancies.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14648588 2003 Isolation and characterization of neural progenitor cells from post-mortem human cortex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464630 2002 A nucleolar mechanism controlling cell proliferation in stem cells and cancer cells.
12429849 2002 Functional proteomic analysis of human nucleolus.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11085516 2000 Effects of estrogen on global gene expression: identification of novel targets of estrogen action.