Property Summary

NCBI Gene PubMed Count 13
PubMed Score 19.22
PubTator Score 12.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.400 6.7e-05
atypical teratoid / rhabdoid tumor -2.300 2.9e-06
Breast cancer -1.800 3.2e-24
ependymoma -1.300 7.3e-08
glioblastoma -1.200 2.5e-04
group 4 medulloblastoma -1.100 3.4e-05
invasive ductal carcinoma -1.323 4.4e-05
lung adenocarcinoma -1.100 1.5e-18
medulloblastoma, large-cell -2.800 4.2e-07
primitive neuroectodermal tumor -1.200 7.7e-04
subependymal giant cell astrocytoma -1.383 2.8e-03

Gene RIF (4)

AA Sequence

MPRKKPFSVKQKKKQLQDKRERKRGLQDGLRSSSNSRSGSRERREEQTDTSDGESVTHHIRRLNQQPSQG      1 - 70
LGPRGYDPNRYRLHFERDSREEVERRKRAAREQVLQPVSAELLELDIREVYQPGSVLDFPRRPPWSYEMS     71 - 140
KEQLMSQEERSFQDYLGKIHGAYSSEKLSYFEHNLETWRQLWRVLEMSDIVLLITDIRHPVVNFPPALYE    141 - 210
YVTGELGLALVLVLNKVDLAPPALVVAWKHYFHQHYPQLHVVLFTSFPRDPRTPQDPSSVLKKSRRRGRG    211 - 280
WTRALGPEQLLRACEAITVGKVDLSSWREKIARDVAGATWGNGSGEEEEEEDGPAVLVEQQTDSAMEPTG    281 - 350
PTQERYKDGVVTIGCVGFPNVGKSSLINGLVGRKVVSVSRTPGHTRYFQTYFLTPSVKLCDCPGLIFPSL    351 - 420
LPRQLQVLAGIYPIAQIQEPYTAVGYLASRIPVQALLHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKT    421 - 490
AKAARNDVYRAANSLLRLAVDGRLSLCFHPPGYSEQKGTWESHPETTELVVLQGRVGPAGDEEEEEEEEL    491 - 560
SSSCEEEGEEDRDADEEGEGDEETPTSAPGSSLAGRNPYALLGEDEC                           561 - 607
//

Text Mined References (23)

PMID Year Title