Property Summary

NCBI Gene PubMed Count 27
PubMed Score 21.60
PubTator Score 5.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Protein-protein Interaction (404)

OR2M5   OR2A25   OR6C74   OR14I1   OR5H15   OR6C68   OR5K3   OR6C6   OR2W5   OR51F1   OR2T8   OR4C46   OR5H14   OR6C70   OR6C65   OR5H1   OR6C75   OR5B21   OR2AG2   OR6C76   OR5K4   OR4C45   OR2AT4   OR7A17   OR1F1   OR2T1   OR10H2   OR10H3   OR7C2   OR1I1   GABBR2   OR2B3   OR2J3   OR2J2   OR7C1   OR7A10   OR2F2   OR6B1   OR4F21   OR2A4   OR5F1   OR6A2   OR2C1   OR2H2   RHO   OR4A8   OR4Q2   OR4E1   OR8U8   OR2T7   OR56A5   GNAT1   OR1E1   OR10J1   OR1D2   OR3A1   OR3A4P   OR1E2   OR3A3   OR1G1   OR3A2   KCNJ4   KCNJ6   KCNJ5   KCNJ3   FNTA   FNTB   OR2B6   OR4D2   OR10A3   OR12D2   KCNJ2   KCNJ10   OR5I1   OR2F1   KCNJ12   OR1Q1   OR4D1   OR8G1   OR1C1   OR8B8   OR7A5   OR2B11   OR10J3   OR2G6   OR5M10   OR4C11   OR4F16   OR2T5   OR2T2   OR8G2   OR2A2   OR52W1   OR4A47   OR10K2   OR52E8   OR6B2   OR7E24   OR2W3   OR4N5   OR4N4   OR8I2   OR5AS1   OR8H3   OR6V1   OR8H2   OR2L13   OR2C3   OR5T1   OR2T33   OR2T12   OR8G5   OR2L5   OR2M7   OR2M3   OR2AK2   OR2L3   OR13H1   OR11H1   OR7G3   OR2Z1   OR7D4   OR7G2   OR7G1   OR1M1   OR10H4   OR10H5   OR4F17   OR4C5   OR4S1   OR4M2   OR4F15   OR4F6   OR5AU1   OR11G2   OR4E2   OR10G2   OR10G3   OR6J1   OR4K17   OR11H6   OR11H7   OR11H4   OR4M1   OR4N2   OR4K2   OR4K5   OR4K1   OR4K14   OR10AD1   OR6C4   OR2AP1   OR10P1   OR10A7   OR9K2   OR4D9   OR9Q2   OR52B6   OR52R1   OR51D1   OR5AP2   OR10W1   OR5B17   OR4B1   OR4X2   OR8J3   OR5T2   OR5T3   OR8H1   OR8K1   OR8B12   OR8A1   OR8B3   OR2D3   OR56A1   OR52L1   OR56A4   OR52E4   OR52N2   OR52N4   OR56B1   OR4D11   OR4D10   OR10V1   OR5AN1   OR5A2   OR5A1   OR4D6   OR52H1   OR52E2   OR51L1   OR51A4   OR51A2   OR51S1   OR51T1   OR51G2   OR51G1   OR52K2   OR52K1   OR52M1   OR52I1   OR5D16   OR5L2   OR5D18   OR5L1   OR5D14   OR5D13   OR4A15   OR4P4   OR4C16   OR4C15   OR6M1   OR8D4   OR4D5   OR6T1   OR10S1   OR10G4   OR10G9   OR10G8   OR10G7   OR4A4P   OR4C13   OR8J1   OR5M9   OR5M3   OR5M8   OR5M1   OR5AR1   OR9G4   OR6Q1   OR1S2   OR10Q1   OR9Q1   OR9I1   OR13A1   OR1L6   OR1K1   OR5C1   OR1L4   OR1B1   OR1L8   OR1N2   OR1N1   OR1J4   OR1J2   OR1J1   OR13F1   OR13C4   OR13C3   OR13C8   OR13C5   OR13C2   OR13C9   OR2K2   OR13J1   OR9A2   OR2A12   OR2A42   OR9A4   OR2I1P   OR2Y1   OR13D1   OR5H6   OR5H2   OR6B3   OR6K6   OR11L1   OR2T34   OR2T35   OR10T2   OR10K1   OR10R2   OR6Y1   OR6P1   OR6K2   OR6K3   OR6N1   OR6N2   OR2L8   OR2AJ1   OR14K1   OR13G1   OR2G3   OR2G2   OR6F1   OR2T10   OR2T4   OR2T11   OR2T29   OR2T3   OR2T27   OR4Q3   OR11H2   OR8S1   OR8U1   OR2L2   OR5J2   OR10AG1   OR4F5   OR4C3   OR6S1   OR4K15   OR4K13   OR4L1   OR5B3   OR4X1   OR8K5   OR8K3   OR52N1   OR56A3   OR52E5   OR52N5   OR51Q1   OR52J3   OR51F2   OR51H1   OR51A7   OR52I2   OR5W2   OR4A16   OR4C6   OR4S2   OR10A6   OR56B4   OR6X1   OR10G6   OR4A5   OR5R1   OR9G1   OR5AK2   OR1S1   OR1L3   OR1L1   OR2AE1   OR1F12   OR2V1   OR5K1   OR5K2   OR10J5   OR14A16   OR14C36   OR2T6   OR51E1   OR8D1   OR5P2   OR5P3   KCNJ9   OR10C1   OR5B12   OR5B2   OR2M4   OR2M2   OR2V2   OR2A7   OR2A14   OR2A5   OR14A2   OR4C12   OR4F4   OR4K3   OR7D2   OR5M11   OR8B4   OR8B2   OR6C1   OR52B2   OR52E6   KCNJ15   OR2B2   OR2H1   OR2J1   OR11A1   OR8D2   OR2AG1   OR10A5   OR10A2   OR10A4   OR2D2   OR51E2   OR52A5   OR51V1   OR51B5   OR51B6   OR51M1   OR51J1   OR51I1   OR51I2   OR52D1   KCNJ16   OR2S2   OR6C3   OR6C2   OR5AC2   OR1A1   GABBR1   OR14J1   OR5V1   OR12D3   OR52A1   OR2W1   OR10H1   OR1A2   OR51B4   OR51B2  

Gene RIF (8)

PMID Text
25916507 Suggest Gbeta4gamma1 as a modulator of M3 muscarinic receptor signaling.
25675501 PhLP1 binding stabilizes the Gbeta fold, disrupting interactions with CCT and releasing a PhLP1-Gbeta dimer for assembly with Ggamma.
23954591 During corticogenesis, a cilium-transduced, noncanonical IGF-1R-Gbetagamma-phospho(T94)Tctex-1 signaling pathway promotes the proliferation of neural progenitors through modulation of ciliary resorption and G1 length.
22065575 WDR26 is a novel Gbetagamma-binding protein that is required for the efficacy of Gbetagamma signaling and leukocyte migration
20048162 Gbetagamma subunits enter in a protein complex with activated Rap1a and its effector Radil; this complex is required downstream of receptor stimulation for the activation of integrins and the positive modulation of cell-matrix adhesiveness.
17548351 Gbetagamma mediates UVB-induced human keratinocyte apoptosis by augmenting the ectodomain shedding of HB-EGF, which sequentially activates EGFR and p38
17110384 G protein betagamma subunits stimulate type V and VI adenylyl cyclases
15901556 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGG      1 - 70
CVIS                                                                       71 - 74
//

Text Mined References (27)

PMID Year Title
25916507 2015 G?4?1 as a modulator of M3 muscarinic receptor signalling and novel roles of G?1 subunits in the modulation of cellular signalling.
25675501 2015 Structures of the G?-CCT and PhLP1-G?-CCT complexes reveal a mechanism for G-protein ?-subunit folding and G?? dimer assembly.
25416956 2014 A proteome-scale map of the human interactome network.
23954591 2013 IGF-1 activates a cilium-localized noncanonical G?? signaling pathway that regulates cell-cycle progression.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
22065575 2011 The WD40 repeat protein WDR26 binds G?? and promotes G??-dependent signal transduction and leukocyte migration.
20048162 2010 G protein betagamma subunits regulate cell adhesion through Rap1a and its effector Radil.
17548351 2007 G Protein betagamma subunits augment UVB-induced apoptosis by stimulating the release of soluble heparin-binding epidermal growth factor from human keratinocytes.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
17110384 2007 Conditional stimulation of type V and VI adenylyl cyclases by G protein betagamma subunits.
15901556 2002 [Analysis of GUCA1B,GNGT1 and RGS9 genes in patients with retinitis pigmentosa].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15368366 2004 Mutation of the highly conserved Arg165 and Glu168 residues of human Gsalpha disrupts the alphaD-alphaE loop and enhances basal GDP/GTP exchange rate.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12486123 2003 Activation of heterotrimeric G proteins by a high energy phosphate transfer via nucleoside diphosphate kinase (NDPK) B and Gbeta subunits. Complex formation of NDPK B with Gbeta gamma dimers and phosphorylation of His-266 IN Gbeta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
10636894 2000 The amino terminus of the fourth cytoplasmic loop of rhodopsin modulates rhodopsin-transducin interaction.
10585447 1999 PHR1 encodes an abundant, pleckstrin homology domain-containing integral membrane protein in the photoreceptor outer segments.
10360181 1999 A molecular mechanism for the phosphorylation-dependent regulation of heterotrimeric G proteins by phosducin.
8661128 1996 Gene structure and chromosome localization to 7q21.3 of the human rod photoreceptor transducin gamma-subunit gene (GNGT1).
8636150 1996 Differential ability to form the G protein betagamma complex among members of the beta and gamma subunit families.
8500562 1993 Structure of the bovine transducin gamma subunit gene and analysis of promoter function in transgenic mice.
7665596 1995 Isolation of cDNA clones encoding eight different human G protein gamma subunits, including three novel forms designated the gamma 4, gamma 10, and gamma 11 subunits.
6438626 1984 Isolation and characterization of a cDNA clone for the gamma subunit of bovine retinal transducin.
1706334 1991 G-protein beta gamma dimers. Membrane targeting requires subunit coexpression and intact gamma C-A-A-X domain.