Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.90
PubTator Score 1.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -1.900 2.0e-05
oligodendroglioma 1.100 1.9e-02
glioblastoma multiforme -1.200 3.2e-06
osteosarcoma 2.322 5.6e-04
ependymoma -1.200 1.0e-03
medulloblastoma 2.300 7.2e-04
atypical teratoid / rhabdoid tumor -2.900 8.1e-04
medulloblastoma, large-cell 2.600 5.0e-05
primitive neuroectodermal tumor 2.100 2.4e-03
tuberculosis -1.100 2.3e-06
non-small cell lung cancer 1.001 8.6e-06
lung cancer 4.600 2.9e-07
cystic fibrosis 1.100 9.7e-04
lung adenocarcinoma 1.200 2.1e-07
pilocytic astrocytoma -1.400 3.4e-03
lung carcinoma 4.800 1.8e-63
Pick disease -1.100 3.0e-03
ovarian cancer -1.200 2.5e-03
Breast cancer 1.500 2.6e-03
pituitary cancer -1.100 5.0e-04

AA Sequence

MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKF      1 - 70
FCTIL                                                                      71 - 75
//

Text Mined References (15)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23021213 2012 TREK-1 and Best1 channels mediate fast and slow glutamate release in astrocytes upon GPCR activation.
17903295 2007 Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15824735 2005 Identification of novel VHL target genes and relationship to hypoxic response pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12626323 2003 Glucagon and regulation of glucose metabolism.
12486123 2003 Activation of heterotrimeric G proteins by a high energy phosphate transfer via nucleoside diphosphate kinase (NDPK) B and Gbeta subunits. Complex formation of NDPK B with Gbeta gamma dimers and phosphorylation of His-266 IN Gbeta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10644457 1999 The G protein subunit gene families.
8636150 1996 Differential ability to form the G protein betagamma complex among members of the beta and gamma subunit families.
7782277 1995 A direct interaction between G-protein beta gamma subunits and the Raf-1 protein kinase.
7665596 1995 Isolation of cDNA clones encoding eight different human G protein gamma subunits, including three novel forms designated the gamma 4, gamma 10, and gamma 11 subunits.