Property Summary

NCBI Gene PubMed Count 19
PubMed Score 4.53
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -3.300 2.4e-03
posterior fossa group B ependymoma -4.100 5.2e-17
oligodendroglioma -2.800 5.4e-20
glioblastoma -3.800 8.6e-06
group 3 medulloblastoma -4.600 2.8e-08
atypical teratoid / rhabdoid tumor -3.500 2.9e-06
medulloblastoma, large-cell -4.100 1.0e-07
primitive neuroectodermal tumor -1.500 3.2e-02
pediatric high grade glioma -3.500 4.1e-08
pilocytic astrocytoma -1.500 3.4e-06
subependymal giant cell astrocytoma -2.853 2.0e-02
Pick disease -1.500 9.9e-03

Gene RIF (3)

PMID Text
23326349 Findings suggest a wide-ranging mechanism by which direct interaction of Gbetagamma with specific chromatin bound transcription factors regulates functional gene networks in response to GPCR activation in cells including the angiotensin II type 1 receptor.
22082156 Knockdown of guanine nucleotide binding protein (G protein), gamma 3 (GNG3) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20534534 Golgi structure and secretion is regulated by receptor-induced G protein betagamma complex translocation

AA Sequence

MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKF      1 - 70
FCALL                                                                      71 - 75
//

Text Mined References (20)

PMID Year Title
26900580 2016 Pathogenic mechanism of recurrent mutations of SCN8A in epileptic encephalopathy.
23326349 2013 Interaction of G-protein ?? complex with chromatin modulates GPCR-dependent gene regulation.
20534534 2010 Regulation of Golgi structure and secretion by receptor-induced G protein ?? complex translocation.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15314181 2004 Mice with deficiency of G protein gamma3 are lean and have seizures.
15078334 2004 Characterization of heterotrimeric G protein complexes in rice plasma membrane.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12626323 2003 Glucagon and regulation of glucose metabolism.
12486123 2003 Activation of heterotrimeric G proteins by a high energy phosphate transfer via nucleoside diphosphate kinase (NDPK) B and Gbeta subunits. Complex formation of NDPK B with Gbeta gamma dimers and phosphorylation of His-266 IN Gbeta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11294873 2001 Gbeta gamma isoforms selectively rescue plasma membrane localization and palmitoylation of mutant Galphas and Galphaq.
10819326 2000 Genomic characterization of the human heterotrimeric G protein alpha, beta, and gamma subunit genes.
10644457 1999 The G protein subunit gene families.
10075696 1999 KSR-1 binds to G-protein betagamma subunits and inhibits beta gamma-induced mitogen-activated protein kinase activation.
9003074 1997 Differential localization of the gamma 3 and gamma 12 subunits of G proteins in the mammalian brain.
8636150 1996 Differential ability to form the G protein betagamma complex among members of the beta and gamma subunit families.
8550614 1996 Intersubunit surfaces in G protein alpha beta gamma heterotrimers. Analysis by cross-linking and mutagenesis of beta gamma.
7822269 1995 Lipid modifications of trimeric G proteins.