Property Summary

NCBI Gene PubMed Count 59
PubMed Score 9.82
PubTator Score 7.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
astrocytoma -1.200 2.4e-12
glioblastoma 1.500 6.7e-06
osteosarcoma -1.702 3.6e-03
ependymoma -1.400 1.0e-03
group 4 medulloblastoma 2.400 9.6e-05
cystic fibrosis 3.392 7.8e-07
atypical teratoid / rhabdoid tumor -2.500 1.5e-02
medulloblastoma, large-cell -2.300 1.1e-02
primitive neuroectodermal tumor 1.100 3.0e-02
Duchenne muscular dystrophy 1.233 6.6e-08
autosomal dominant Emery-Dreifuss muscul... 1.060 3.1e-03
adrenocortical carcinoma -1.356 3.9e-02
non-small cell lung cancer -1.350 4.0e-13
intraductal papillary-mucinous adenoma (... -1.600 2.9e-02
intraductal papillary-mucinous carcinoma... -2.300 6.7e-03
intraductal papillary-mucinous neoplasm ... -2.400 2.4e-02
active Crohn's disease -1.555 1.6e-02
active ulcerative colitis -2.061 1.7e-02
sarcoidosis 1.300 3.6e-03
interstitial cystitis 1.600 1.0e-04
pilocytic astrocytoma 1.100 2.7e-03
primary Sjogren syndrome 1.900 5.3e-04
lung carcinoma -1.300 6.0e-14
breast carcinoma -1.400 3.4e-17
Pick disease -1.800 1.5e-02
ductal carcinoma in situ -2.100 3.7e-04
invasive ductal carcinoma -2.900 2.9e-04
ovarian cancer -3.600 2.7e-11
pituitary cancer 1.100 1.3e-05

Gene RIF (14)

PMID Text
25941381 G-protein betagamma subunits are positive regulators of Kv7.4 and native vascular Kv7 channel activity.
25367286 Alteration of gene expression profiling including GPR174 and GNG2 is associated with vasovagal syncope.
24462769 Data indicate that endogenous mTOR interacts with Gbetagamma.
23031273 increased protein expression level of GNG2 alone inhibits proliferation of malignant melanoma cells in vitro and in vivo
22957104 presence of Gng2 and Netrin-G2 immunoreactive elements in the insular cortex, but not in the putamen, suggests a possible common ontogeny of the claustrum and insula
21679469 Gbetagamma inhibits Epac-induced Ca 2+ elevation in melanoma cells. Cross talk of Ca 2+ signaling between Gbetagamma & Epac plays a major role in melanoma cell migration.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20181083 Data implicate the domain I-II linker region as an important contributor to voltage dependent Gbeta1/Ggamma2 modulation of Cav2.2 calcium channels.
20007712 Data show that activation of PLCbeta(2) by alpha(q) and beta1gamma2 differ from activation by Rac2 and from each other.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18045877 signaling pathway by which G(i)-coupled receptor specifically induces Rac and Cdc42 activation through direct interaction of Gbetagamma with FLJ00018.
17492941 Fission of transport carriers at the trans-Golgi network is dependent on specifically PLCbeta3, which is necessary to activate PKCeta and PKD in that Golgi compartment, via diacylglycerol production.
15747776 10 genes were down-regulated following treatment of the T-ALL cells with 0.15 and 1.5 microg/mL of metal ores at 72 h
15105422 Data show that G protein inhibition of N-type calcium channels is critically dependent on two separate but adjacent approximately 20-amino acid regions of the Gbeta subunit, as examined with Gbetas 1 and 5 and Ggamma2.

AA Sequence

MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI      1 - 70
L//

Text Mined References (65)

PMID Year Title
25941381 2015 G-protein ?? subunits are positive regulators of Kv7.4 and native vascular Kv7 channel activity.
25367286 2015 Alteration of gene expression profiling including GPR174 and GNG2 is associated with vasovagal syncope.
24658283 2014 A genome-wide gene-environment interaction analysis for tobacco smoke and lung cancer susceptibility.
24462769 2014 G?? interacts with mTOR and promotes its activation.
23548203 2013 Genome-wide association studies identify several new loci associated with pigmentation traits and skin cancer risk in European Americans.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23031273 2012 Functional analysis of GNG2 in human malignant melanoma cells.
22957104 2012 Topography of Gng2- and NetrinG2-expression suggests an insular origin of the human claustrum.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21827955 2011 Retraction notice to: Structure of the parathyroid hormone receptor C terminus bound to the G-protein dimer G?1?2.
21679469 2011 G?? subunits inhibit Epac-induced melanoma cell migration.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20181083 2010 Scanning mutagenesis of the I-II loop of the Cav2.2 calcium channel identifies residues Arginine 376 and Valine 416 as molecular determinants of voltage dependent G protein inhibition.
20007712 2010 Differential regulation of phospholipase C-beta2 activity and membrane interaction by Galphaq, Gbeta1gamma2, and Rac2.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19713215 2009 Regulation of immature dendritic cell migration by RhoA guanine nucleotide exchange factor Arhgef5.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18611381 2008 Structure of the parathyroid hormone receptor C terminus bound to the G-protein dimer Gbeta1gamma2.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18045877 2008 Heterotrimeric G protein betagamma subunits stimulate FLJ00018, a guanine nucleotide exchange factor for Rac1 and Cdc42.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17492941 2007 Phospholipase C beta3 is a key component in the Gbetagamma/PKCeta/PKD-mediated regulation of trans-Golgi network to plasma membrane transport.
16892066 2006 Mechanism of the receptor-catalyzed activation of heterotrimeric G proteins.
16418336 2006 The G12 family of G proteins as a reporter of thromboxane A2 receptor activity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16102047 2005 Protease-activated receptors in hemostasis, thrombosis and vascular biology.
16099817 2006 A docking site for G protein ?? subunits on the parathyroid hormone 1 receptor supports signaling through multiple pathways.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15747776 2003 Dose-dependent transcriptome changes by metal ores on a human acute lymphoblastic leukemia cell line.
15611108 2005 Regulatory interactions between the amino terminus of G-protein betagamma subunits and the catalytic domain of phospholipase Cbeta2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451670 2004 Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
15105422 2004 A single Gbeta subunit locus controls cross-talk between protein kinase C and G protein regulation of N-type calcium channels.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14512443 2003 G Protein betagamma subunits stimulate p114RhoGEF, a guanine nucleotide exchange factor for RhoA and Rac1: regulation of cell shape and reactive oxygen species production.
12853961 2003 T-type calcium channel regulation by specific G-protein betagamma subunits.
12626323 2003 Glucagon and regulation of glucose metabolism.
12606627 2003 Direct interactions between the heterotrimeric G protein subunit G beta 5 and the G protein gamma subunit-like domain-containing regulator of G protein signaling 11: gain of function of cyan fluorescent protein-tagged G gamma 3.
12527722 2003 The familial hemiplegic migraine mutation R192Q reduces G-protein-mediated inhibition of P/Q-type (Ca(V)2.1) calcium channels expressed in human embryonic kidney cells.
12507995 2003 Roles of G beta gamma in membrane recruitment and activation of p110 gamma/p101 phosphoinositide 3-kinase gamma.
12486123 2003 Activation of heterotrimeric G proteins by a high energy phosphate transfer via nucleoside diphosphate kinase (NDPK) B and Gbeta subunits. Complex formation of NDPK B with Gbeta gamma dimers and phosphorylation of His-266 IN Gbeta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698416 2002 G Protein beta gamma subunits act on the catalytic domain to stimulate Bruton's agammaglobulinemia tyrosine kinase.
11483580 2001 Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.
11313909 2001 G(z) signaling: emerging divergence from G(i) signaling.
11294873 2001 Gbeta gamma isoforms selectively rescue plasma membrane localization and palmitoylation of mutant Galphas and Galphaq.
11196645 2001 Identification of the platelet ADP receptor targeted by antithrombotic drugs.
10833460 2000 Cloning, characterization, and mapping of the gene encoding the human G protein gamma 2 subunit.
10744734 2000 Mutational analysis of Gbetagamma and phospholipid interaction with G protein-coupled receptor kinase 2.
10518015 1999 Association of the proto-oncogene product dbl with G protein betagamma subunits.
9286705 1997 Gene structure and chromosome localization of the G gamma c subunit of human cone G-protein (GNGT2).
9238069 1997 Direct interaction of gbetagamma with a C-terminal gbetagamma-binding domain of the Ca2+ channel alpha1 subunit is responsible for channel inhibition by G protein-coupled receptors.
9152406 1997 The human thromboxane A2 receptor alpha isoform (TP alpha) functionally couples to the G proteins Gq and G11 in vivo and is activated by the isoprostane 8-epi prostaglandin F2 alpha.
9063897 1997 Molecular basis of receptor/G protein coupling selectivity studied by coexpression of wild type and mutant m2 muscarinic receptors with mutant G alpha(q) subunits.
9009193 1997 Direct binding of G-protein betagamma complex to voltage-dependent calcium channels.
8636150 1996 Differential ability to form the G protein betagamma complex among members of the beta and gamma subunit families.
8521505 1995 The structure of the G protein heterotrimer Gi alpha 1 beta 1 gamma 2.
8290554 1994 G proteins of the G12 family are activated via thromboxane A2 and thrombin receptors in human platelets.
8208289 1994 Structural determinants for activation of the alpha-subunit of a heterotrimeric G protein.
7972043 1994 Binding of beta gamma subunits of heterotrimeric G proteins to the PH domain of Bruton tyrosine kinase.
7782277 1995 A direct interaction between G-protein beta gamma subunits and the Raf-1 protein kinase.
7624799 1995 Cloning and characterization of a G protein-activated human phosphoinositide-3 kinase.