Property Summary

NCBI Gene PubMed Count 22
PubMed Score 1.92
PubTator Score 2.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis -1.200 1.3e-04
glioblastoma 1.700 6.6e-05
osteosarcoma 2.761 8.7e-06
ependymoma 1.800 1.4e-17
intraductal papillary-mucinous neoplasm ... 1.700 1.1e-02
diabetes mellitus -1.100 3.2e-03
pediatric high grade glioma 1.600 6.9e-05
pilocytic astrocytoma 2.000 5.7e-12
subependymal giant cell astrocytoma 1.958 3.0e-02
Pick disease 1.200 2.1e-02
Breast cancer -1.100 6.5e-05
mucosa-associated lymphoid tissue lympho... 2.540 2.8e-02
ductal carcinoma in situ -1.100 1.6e-03
invasive ductal carcinoma -2.000 1.8e-03
ovarian cancer -2.800 5.2e-11
head and neck cancer -1.100 1.1e-02

AA Sequence

MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCI      1 - 70
IL                                                                         71 - 72
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023390 2013 Large-scale top-down proteomics of the human proteome: membrane proteins, mitochondria, and senescence.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15078334 2004 Characterization of heterotrimeric G protein complexes in rice plasma membrane.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12626323 2003 Glucagon and regulation of glucose metabolism.
12486123 2003 Activation of heterotrimeric G proteins by a high energy phosphate transfer via nucleoside diphosphate kinase (NDPK) B and Gbeta subunits. Complex formation of NDPK B with Gbeta gamma dimers and phosphorylation of His-266 IN Gbeta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11714923 2001 Identification of a region in G protein gamma subunits conserved across species but hypervariable among subunit isoforms.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10819326 2000 Genomic characterization of the human heterotrimeric G protein alpha, beta, and gamma subunit genes.
10409705 1999 Selective association of G protein beta(4) with gamma(5) and gamma(12) subunits in bovine tissues.
9003074 1997 Differential localization of the gamma 3 and gamma 12 subunits of G proteins in the mammalian brain.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7493986 1995 Primary structure of a gamma subunit of G protein, gamma 12, and its phosphorylation by protein kinase C.