Property Summary

NCBI Gene PubMed Count 25
PubMed Score 4.23
PubTator Score 6.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Rheumatoid Arthritis 1.200 3.6e-03
astrocytoma 1.100 5.9e-15
glioblastoma 1.400 3.7e-03
osteosarcoma 2.591 5.5e-05
chronic lymphosyte leukemia -2.100 1.5e-04
medulloblastoma, large-cell -2.200 5.6e-03
Duchenne muscular dystrophy 1.982 2.7e-09
Becker muscular dystrophy 1.067 2.0e-02
autosomal dominant Emery-Dreifuss muscul... 1.597 1.0e-03
juvenile dermatomyositis 2.137 8.8e-14
primary pancreatic ductal adenocarcinoma 2.484 4.9e-04
intraductal papillary-mucinous adenoma (... -2.600 1.3e-02
active Crohn's disease 1.321 2.7e-02
sarcoidosis 1.200 1.1e-02
Breast cancer 2.000 3.0e-02
pediatric high grade glioma 1.500 9.5e-05
pilocytic astrocytoma 1.100 5.0e-03
primary Sjogren syndrome 1.300 1.2e-03
subependymal giant cell astrocytoma 1.396 3.2e-02
invasive ductal carcinoma 1.185 2.2e-03
lung carcinoma -1.900 7.2e-27
ulcerative colitis 2.500 1.6e-06
ovarian cancer 3.100 3.3e-05
pancreatic cancer 2.500 1.1e-03

Gene RIF (8)

PMID Text
25916507 Suggest Gbeta4gamma1 as a modulator of M3 muscarinic receptor signaling.
23434117 Analysis of GNB4 in an additional 88 unrelated CMT individuals uncovered another de novo mutation.
19414374 Intron-1 haplotypes of GNB4 is associated with colorectal carcinoma.
19414374 Observational study of gene-disease association. (HuGE Navigator)
18815590 Intron-1 haplotypes of GNB4 may, thus, serve as predictive markers for progression and survival of patients suffering from bladder cancer.
18815590 Observational study of gene-disease association. (HuGE Navigator)
12782285 Gbeta4 is widely expressed, located on chromosome 3 with a genomic structure like Gbeta1 to Gbeta3, but different from Gbeta5
12454992 Gbeta4 subunit is coexpressed in physiologically ON-type cone bipolar cells with Ggamma13 and Gbeta3 but is not present in OFF-type bipolar cells.

AA Sequence

MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLL      1 - 70
VSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELP     71 - 140
GHTGYLSCCRFLDDSQIVTSSGDTTCALWDIETAQQTTTFTGHSGDVMSLSLSPDMRTFVSGACDASSKL    141 - 210
WDIRDGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSK    211 - 280
SGRLLLAGYDDFNCNVWDTLKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN              281 - 340
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25916507 2015 G?4?1 as a modulator of M3 muscarinic receptor signalling and novel roles of G?1 subunits in the modulation of cellular signalling.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23434117 2013 Exome sequencing identifies GNB4 mutations as a cause of dominant intermediate Charcot-Marie-Tooth disease.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
21269460 2011 Initial characterization of the human central proteome.
19414374 2009 Association of GNB4 intron-1 haplotypes with survival in patients with UICC stage III and IV colorectal carcinoma.
18815590 2008 Characterization of intron-1 haplotypes of the G protein beta 4 subunit gene--association with survival and progression in patients with urothelial bladder carcinoma.
17897319 2007 Integral and associated lysosomal membrane proteins.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12782285 2003 The human G protein beta4 subunit: gene structure, expression, Ggamma and effector interaction.
12626323 2003 Glucagon and regulation of glucose metabolism.
12512701 2002 The role of G protein beta subunits in the release of ATP from human erythrocytes.
12486123 2003 Activation of heterotrimeric G proteins by a high energy phosphate transfer via nucleoside diphosphate kinase (NDPK) B and Gbeta subunits. Complex formation of NDPK B with Gbeta gamma dimers and phosphorylation of His-266 IN Gbeta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12454992 2003 G protein subunit G gamma 13 is coexpressed with G alpha o, G beta 3, and G beta 4 in retinal ON bipolar cells.
11842130 2002 Cloning, tissue distribution, and functional expression of the human G protein beta 4-subunit.
11294873 2001 Gbeta gamma isoforms selectively rescue plasma membrane localization and palmitoylation of mutant Galphas and Galphaq.
10644457 1999 The G protein subunit gene families.
10570481 1999 Ggamma13 colocalizes with gustducin in taste receptor cells and mediates IP3 responses to bitter denatonium.
10409705 1999 Selective association of G protein beta(4) with gamma(5) and gamma(12) subunits in bovine tissues.
8888689 1996 Selectively enhanced cellular signaling by Gi proteins in essential hypertension. G alpha i2, G alpha i3, G beta 1, and G beta 2 are not mutated.