Property Summary

NCBI Gene PubMed Count 381
PubMed Score 235.80
PubTator Score 500.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.900 4.9e-03
medulloblastoma, large-cell 1.500 9.7e-03
pituitary cancer 2.500 1.7e-08

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (454)

AA Sequence

MGEMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLL      1 - 70
VSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELS     71 - 140
AHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKL    141 - 210
WDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESIICGITSVAFSL    211 - 280
SGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN              281 - 340
//

Text Mined References (381)

PMID Year Title