Property Summary

NCBI Gene PubMed Count 46
PubMed Score 2.98
PubTator Score 4.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 6.9e-06
ovarian cancer 8491 7.4e-06
Multiple myeloma 1327 1.2e-04
osteosarcoma 7933 2.0e-04
glioblastoma 5572 1.3e-02

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.381 1.2e-04
psoriasis 3.100 6.9e-06
osteosarcoma 1.025 2.0e-04
glioblastoma 1.200 1.3e-02
ovarian cancer 2.200 7.4e-06

Gene RIF (6)

PMID Text
25485910 GNB1 and GNB2 alterations confer transformed and resistance phenotypes across a range of human tumors and may be targetable with inhibitors of G protein signaling.
23043599 MIF and GNbeta2 interacted with influenza A H1N1 virus PB1-F2 protein.
22917497 Results indicate that G protein beta2 (Gbeta2) is required for starvation-induced NF-kappaB activation and constitutive NF-kappaB activity.
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
16973746 Recombinant Gbetagamma subunits were used to establish that the Gbeta(2)gamma(2) dimer can selectively reconstitute the inhibition of alpha(1H) channels in isolated membrane patches.
15955845 We conclude that the Gbetagamma complex interacts with the GR and suppresses its transcriptional activity by associating with the transcriptional complex formed on GR-responsive promoters.

AA Sequence

MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLL      1 - 70
VSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELP     71 - 140
GHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKL    141 - 210
WDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSR    211 - 280
SGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN              281 - 340
//

Text Mined References (51)

PMID Year Title
26900580 2016 Pathogenic mechanism of recurrent mutations of SCN8A in epileptic encephalopathy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25485910 2015 Mutations in G protein ? subunits promote transformation and kinase inhibitor resistance.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23043599 2012 Identification of cellular proteins interacting with influenza A virus PB1-F2 protein.
22917497 2012 Serum starvation activates NF-?B through G protein ?2 subunit-mediated signal.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19255495 2009 The cationic region of Rhes mediates its interactions with specific Gbeta subunits.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
17897319 2007 Integral and associated lysosomal membrane proteins.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
16973746 2006 The molecular basis for T-type Ca2+ channel inhibition by G protein beta2gamma2 subunits.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16498633 2006 Ataxin 10 induces neuritogenesis via interaction with G-protein beta2 subunit.
16341674 2005 Transcriptome analysis of human gastric cancer.
15955845 2005 G protein beta interacts with the glucocorticoid receptor and suppresses its transcriptional activity in the nucleus.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14512443 2003 G Protein betagamma subunits stimulate p114RhoGEF, a guanine nucleotide exchange factor for RhoA and Rac1: regulation of cell shape and reactive oxygen species production.
12853948 2003 The DNA sequence of human chromosome 7.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12626323 2003 Glucagon and regulation of glucose metabolism.
12512701 2002 The role of G protein beta subunits in the release of ATP from human erythrocytes.
12486123 2003 Activation of heterotrimeric G proteins by a high energy phosphate transfer via nucleoside diphosphate kinase (NDPK) B and Gbeta subunits. Complex formation of NDPK B with Gbeta gamma dimers and phosphorylation of His-266 IN Gbeta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11675383 2001 G beta association and effector interaction selectivities of the divergent G gamma subunit G gamma(13).
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
10644457 1999 The G protein subunit gene families.
10409705 1999 Selective association of G protein beta(4) with gamma(5) and gamma(12) subunits in bovine tissues.
9921901 1998 CCG repeats in cDNAs from human brain.
9799793 1998 Large-scale sequencing of two regions in human chromosome 7q22: analysis of 650 kb of genomic sequence around the EPO and CUTL1 loci reveals 17 genes.
9648884 1998 Immunohistochemical localization of G protein beta1, beta2, beta3, beta4, beta5, and gamma3 subunits in the adult rat brain.
8308009 1994 G protein beta gamma subunits. Simplified purification and properties of novel isoforms.
7782277 1995 A direct interaction between G-protein beta gamma subunits and the Raf-1 protein kinase.
7665596 1995 Isolation of cDNA clones encoding eight different human G protein gamma subunits, including three novel forms designated the gamma 4, gamma 10, and gamma 11 subunits.
7649993 1995 Mitogen-activated protein kinase activation requires two signal inputs from the human anaphylatoxin C5a receptor.
3114742 1987 A second form of the beta subunit of signal-transducing G proteins.
3108879 1987 Distinct forms of the beta subunit of GTP-binding regulatory proteins identified by molecular cloning.
2902634 1988 Chromosomal localization of genes encoding guanine nucleotide-binding protein subunits in mouse and human.
1946378 1991 Direct selection: a method for the isolation of cDNAs encoded by large genomic regions.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.