Property Summary

NCBI Gene PubMed Count 14
PubMed Score 75.56
PubTator Score 34.93

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.300 3.8e-05
psoriasis 1.100 6.1e-04

Synonym

Accession Q9BYB4 Q9H2S2 Q9H4M4 G protein subunit beta-like protein 1
Symbols GY2
FKSG1
WDR14
WDVCF
DGCRK3

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (9)

PMID Text
24831436 mRNA expression results implies that the GNB1L high-expression allele is the risk allele for schizophrenia and bipolar disorder in the Han Chinese population.
20860462 Beta-blocker therapy and heart rate control during exercise testing in the general population: role of GNB1L variant.
20538345 The results of this study suggested that GNB1L is linked with bipolar disorder and schizophrenia and not with major depressive disorder.
20538345 Observational study of gene-disease association. (HuGE Navigator)
19011233 The present findings support assertions that GNB1L is one of the genes in the 22q11DS region responsible for increasing the risk of schizophrenia.
19011233 Observational study of gene-disease association. (HuGE Navigator)
18755269 GbetaL is involved in the negative regulation of TNFalpha-stimulated NF-kappaB signaling through a direct interaction with IKK.
18003636 markers associated with psychosis are also correlated with alterations in GNB1L expression, raising the hypothesis that the risk to develop psychosis at this locus could be mediated in a dose sensitive manner via gene expression
18003636 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAVTTLDGHGGQC      1 - 70
VTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEV     71 - 140
QILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDVSEQKVCSRIACHEEP    141 - 210
VMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVF    211 - 280
HWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA                           281 - 327
//

Text Mined References (16)

PMID Year Title
24831436 2015 The schizophrenia/bipolar disorder candidate gene GNB1L is regulated in human temporal cortex by a cis-acting element located within the 3'-region.
21269460 2011 Initial characterization of the human central proteome.
20860462 2010 ?-blocker therapy and heart rate control during exercise testing in the general population: role of a common G-protein ?-3 subunit variant.
20538345 2011 Association study between GNB1L and three major mental disorders in Chinese Han populations.
19011233 2010 Supportive evidence for reduced expression of GNB1L in schizophrenia.
18755269 2008 GbetaL regulates TNFalpha-induced NF-kappaB signaling by directly inhibiting the activation of IkappaB kinase.
18003636 2008 Strong evidence that GNB1L is associated with schizophrenia.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15268862 2004 Rictor, a novel binding partner of mTOR, defines a rapamycin-insensitive and raptor-independent pathway that regulates the cytoskeleton.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11350118 2001 Isolation and characterization of a novel gene containing WD40 repeats from the region deleted in velo-cardio-facial/DiGeorge syndrome on chromosome 22q11.
11258795 2001 Identification of novel transcribed sequences on human chromosome 22 by expressed sequence tag mapping.
11072084 2000 GNB1L, a gene deleted in the critical region for DiGeorge syndrome on 22q11, encodes a G-protein beta-subunit-like polypeptide.
10591208 1999 The DNA sequence of human chromosome 22.