Property Summary

NCBI Gene PubMed Count 14
PubMed Score 77.06
PubTator Score 34.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.300 3.8e-05
psoriasis 1.100 6.1e-04

Gene RIF (9)

AA Sequence

MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAVTTLDGHGGQC      1 - 70
VTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEV     71 - 140
QILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDVSEQKVCSRIACHEEP    141 - 210
VMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVF    211 - 280
HWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA                           281 - 327
//

Text Mined References (16)

PMID Year Title