Property Summary

NCBI Gene PubMed Count 96
PubMed Score 19.34
PubTator Score 9.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.083 6.0e-06
Breast cancer 2.600 2.7e-02
chronic kidney disease 1.200 2.9e-02
Duchenne muscular dystrophy 1.110 1.9e-08
group 4 medulloblastoma 1.100 1.2e-02
juvenile dermatomyositis 1.048 4.2e-12
lung adenocarcinoma 1.214 4.5e-07
Multiple myeloma 1.253 1.5e-03
non primary Sjogren syndrome sicca 1.200 1.4e-02
osteosarcoma 1.608 3.6e-05
ovarian cancer -1.600 5.4e-07
pancreatic cancer 1.100 3.8e-03
primary pancreatic ductal adenocarcinoma 1.249 1.1e-02
Rheumatoid arthritis 1.100 1.4e-03
subependymal giant cell astrocytoma -1.260 1.9e-02

 GWAS Trait (1)

Protein-protein Interaction (3)

PDB (10)

Gene RIF (36)

AA Sequence

MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLL      1 - 70
VSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELA     71 - 140
GHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKL    141 - 210
WDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSK    211 - 280
SGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN              281 - 340
//

Text Mined References (106)

PMID Year Title