Property Summary

NCBI Gene PubMed Count 39
PubMed Score 38.56
PubTator Score 45.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.100 3.3e-02
cutaneous lupus erythematosus -1.100 2.7e-02
psoriasis -2.000 1.3e-04
osteosarcoma -2.796 4.4e-09
glioblastoma -2.100 9.8e-06
atypical teratoid / rhabdoid tumor -2.400 1.8e-07
medulloblastoma, large-cell -1.700 2.7e-04
colon cancer -1.300 2.9e-04
lung cancer 1.700 8.0e-05
breast carcinoma -1.500 4.2e-04
pediatric high grade glioma -1.800 5.6e-07
pilocytic astrocytoma -1.200 2.7e-06
subependymal giant cell astrocytoma -1.523 4.3e-02
lung adenocarcinoma -1.900 4.6e-07
lung carcinoma 1.100 1.6e-19

Gene RIF (3)

PMID Text
20424519 GNAZ mutations are associated with melanoma.
19946729 cGMP-phosphodiesterase 6 can be activated by another cancer-retina antigen, transducin, through Wnt5a-Frizzled-2 cascade, which leads to a lowering of cGMP and an increase in intracellular calcium mobilization.
15326221 findings suggest that Galphaz signals may attenuate Rho-induced stimulation of SRF-mediated transcription

AA Sequence

MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGGFNLEACKEYK      1 - 70
PLIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQAC     71 - 140
FSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERK    141 - 210
KWIHCFEGVTAIIFCVELSGYDLKLYEDNQTSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIR    211 - 280
RIPLTICFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLK    281 - 350
YIGLC                                                                     351 - 355
//

Text Mined References (40)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20424519 2010 Novel somatic mutations in heterotrimeric G proteins in melanoma.
19946729 2010 cGMP-phosphodiesterase 6, transducin and Wnt5a/Frizzled-2-signaling control cGMP and Ca(2+) homeostasis in melanoma cells.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16892066 2006 Mechanism of the receptor-catalyzed activation of heterotrimeric G proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15326221 2004 Galphaz inhibits serum response factor-dependent transcription by inhibiting Rho signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414994 2002 Inactivation of Galpha(z) causes disassembly of the Golgi apparatus.
11950062 2002 Impaired interactions between mouse Eyal harboring mutations found in patients with branchio-oto-renal syndrome and Six, Dach, and G proteins.
11313909 2001 G(z) signaling: emerging divergence from G(i) signaling.
11118617 2000 Cloning and characterization of the human phosphoinositide-specific phospholipase C-beta 1 (PLC beta 1).
10906137 2000 The alpha subunits of Gz and Gi interact with the eyes absent transcription cofactor Eya2, preventing its interaction with the six class of homeodomain-containing proteins.
10593970 1999 Functional interaction between Galpha(z) and Rap1GAP suggests a novel form of cellular cross-talk.
10092682 1999 RGS7 and RGS8 differentially accelerate G protein-mediated modulation of K+ currents.
9748279 1998 RGSZ1, a Gz-selective regulator of G protein signaling whose action is sensitive to the phosphorylation state of Gzalpha.
9647645 1998 The mammalian calcium-binding protein, nucleobindin (CALNUC), is a Golgi resident protein.
9603210 1998 Multiple coupling of human D5 dopamine receptors to guanine nucleotide binding proteins Gs and Gz.
9166747 1997 Functional role of amino-terminal serine16 and serine27 of G alphaZ in receptor and effector coupling.
8986788 1996 GAIP is membrane-anchored by palmitoylation and interacts with the activated (GTP-bound) form of G alpha i subunits.
8975005 1995 GNAZ in human fetal cochlea: expression, localization, and potential role in inner ear function.
8774883 1996 RGS10 is a selective activator of G alpha i GTPase activity.
8521505 1995 The structure of the G protein heterotrimer Gi alpha 1 beta 1 gamma 2.
8475115 1993 Lipid modifications of G proteins: alpha subunits are palmitoylated.
8429024 1993 Analysis of Gz alpha by site-directed mutagenesis. Sites and specificity of protein kinase C-dependent phosphorylation.
8208289 1994 Structural determinants for activation of the alpha-subunit of a heterotrimeric G protein.
7559455 1995 Phosphorylation of Gz alpha by protein kinase C blocks interaction with the beta gamma complex.
3129724 1988 Identification of a GTP-binding protein alpha subunit that lacks an apparent ADP-ribosylation site for pertussis toxin.
2902634 1988 Chromosomal localization of genes encoding guanine nucleotide-binding protein subunits in mouse and human.
2456569 1988 Sequence analysis of cDNA and genomic DNA for a putative pertussis toxin-insensitive guanine nucleotide-binding regulatory protein alpha subunit.
2153964 1990 G-protein alpha-subunit expression, myristoylation, and membrane association in COS cells.
2117645 1990 Novel localization of a G protein, Gz-alpha, in neurons of brain and retina.
2115889 1990 Characterization of the human gene for Gx alpha, a pertussis toxin-insensitive regulatory GTP-binding protein.
1908722 1991 Identification of Gz alpha as a pertussis toxin-insensitive G protein in human platelets and megakaryocytes.
1902575 1991 Guanine nucleotide-binding regulatory proteins in retinal pigment epithelial cells.
1302014 1992 Evolution of the mammalian G protein alpha subunit multigene family.