Property Summary

NCBI Gene PubMed Count 21
PubMed Score 189.31
PubTator Score 20.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Infertility, Male 46 0.0 0.0
Disease Target Count
Male infertility 206

Expression

Gene RIF (6)

AA Sequence

MGSGISSESKESAKRSKELEKKLQEDAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNGYSEQECMEFK      1 - 70
AVIYSNTLQSILAIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMTPQLAEVIKRLWRDPGIQACF     71 - 140
ERASEYQLNDSAAYYLNDLDRITASGYVPNEQDVLHSRVKTTGIIETQFSFKDLHFRMFDVGGQRSERKK    141 - 210
WIHCFEGVTCIIFCAALSAYDMVLVEDEEVNRMHESLHLFNSICNHKYFSTTSIVLFLNKKDIFQEKVTK    211 - 280
VHLSICFPEYTGPNTFEDAGNYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKD    281 - 350
CGLF                                                                      351 - 354
//

Text Mined References (22)

PMID Year Title