Property Summary

NCBI Gene PubMed Count 190
PubMed Score 492.80
PubTator Score 265.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
DOID:2415 4 0.0 1.0
Melanoma 261 0.0 1.0
Ocular cancer 5 0.0 1.0
Skin cancer 37 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 4.131 2.1
Mongolian spot 3 3.453 1.7
Impotence 45 3.369 1.7
Disease Target Count
Capillary malformations, congenital 1

Expression

  Differential Expression (25)

Disease log2 FC p
Rheumatoid Arthritis 2.000 2.3e-03
psoriasis -1.600 9.9e-05
osteosarcoma 4.141 4.0e-12
ependymoma -1.100 2.5e-07
medulloblastoma -1.600 3.0e-04
atypical teratoid / rhabdoid tumor -1.700 5.6e-06
glioblastoma -1.200 3.1e-04
medulloblastoma, large-cell -1.900 1.9e-05
Crohn's disease -1.142 7.5e-03
ulcerative colitis -1.445 8.6e-03
juvenile dermatomyositis 1.035 2.6e-09
tuberculosis and treatment for 3 months 1.300 2.2e-06
non-small cell lung cancer -1.719 1.2e-25
intraductal papillary-mucinous adenoma (... 1.700 5.9e-04
intraductal papillary-mucinous carcinoma... 1.600 5.8e-04
intraductal papillary-mucinous neoplasm ... 1.600 1.1e-02
lung cancer -3.800 6.4e-07
colon cancer -1.400 3.8e-04
Breast cancer 2.800 2.7e-02
lung adenocarcinoma -1.800 2.7e-21
adult high grade glioma -1.100 9.1e-03
Pick disease -1.100 1.4e-04
progressive supranuclear palsy -1.200 1.2e-02
ovarian cancer -1.500 1.1e-04
pancreatic cancer 1.100 1.7e-02

Gene RIF (127)

PMID Text
27058448 The Glu209 GNAQ and GNA11 missense variants we identified are common in uveal melanoma and have been shown to constitutively activate MAPK and/or YAP signaling. Our data indicate that chorangioma is probably not the placental counterpart of congenital hemangiomas associated with mutations altering Gln209 in GNAQ or GNA11.
26887939 data suggest that the interaction between this novel region in Galphaq and the effector PKCzeta is a key event in Galphaq signaling.
26865629 findings demonstrate that hNPS-(1-10) is a biased agonist favoring Galphaq-dependent signaling. It may represent a valuable chemical probe for further investigation of the therapeutic potential of human NPS receptor-directed signalingin vivo.
26778290 extensive dermal melanocytosis and phakomatosis pigmentovascularis are associated with activating mutations in GNA11 and GNAQ, genes that encode Galpha subunits of heterotrimeric G proteins
26775782 We conclude that enrichment of GNAQ (R183Q) in port-wine stain (PWS) blood vessels may induce consecutive activation of c-Jun N-terminal kinases and extracellular signal regulated kinases, thus contributing to the pathogenesis of PWS.
26368812 Distribution of GNAQ and GNA11 Mutation Signatures in Uveal Melanoma Points to a Light Dependent Mutation Mechanism.
26192947 This is the second largest study on isolated, non-syndromic Port-wine stain; data suggest that GNAQ is the main genetic determinant in this condition. Moreover, isolated port-wine stains are distinct from capillary malformations seen in RASA1 disorders.
25955651 The results suggested that GNAQ mutation induced viability and migration of uveal melanoma cells via Notch signaling activation, which is mediated by YAP dephosphorylation and nuclear translocation.
25732870 Galphaq expression was negatively associated with interleukin-17A expression in RA patients, indicating that Galphaq negatively controlled the differentiation of Th17 cells.
25695059 Involved in the MAPK/ERK, PI3K/AKT, and GNAQ/11 pathways.
25653058 Knockdown of GNAQ with siRNA-AuNPs effectively reduced downstream signals and decreased cell viability in GNAQ mutant uveal melanoma cells.
25433904 This study demonstrated that the GNAQ protein was reduced in auditory cortex patient with schizophreia.
25420509 Diacylglycerol mediates regulation of TASK1 and TASK3 potassium channels by GNAQ.
25374402 These findings suggest that the recurrent somatic GNAQ mutation c.548G>A is the major determinant genetic factor for Sturge-Weber syndrome and imply that other mutated candidate gene(s) may exist in Sturge-Weber syndrome
25363280 no GNAQ mutations were observed in African acral melanomas
25316767 Results uncovered that Gaq binding to GRK2 enhances the recruitment of GRK2 to M3-ACh receptors.
25304237 review discusses the multiple activated signaling targets downstream of mutant GNAQ and GNA11 in uveal melanoma, including MEK, PI3-kinase/Akt, protein kinase C, and YAP
25280020 Oncogenic GNAQ mutation is associated with uveal melanoma.
24970262 There was no association of GNAQ mutation status with metastatic status in uveal melanoma.
24927141 Our finding of the frameshift deletion (p.H387fs) in exon 4 of SOX10 in uveal melanoma (UM) provides an important insight and complements earlier findings of mutations in GNAQ and SF3B1 on the genomic basis of UM.
24882515 GNAQ oncogenic signaling induced YPA nuclear translocation and YAP-dependent transcription activation throuch Rho-GTPases and actin remodeling.
24595385 PKC inhibitors combined with IR significantly decreased the viability, proliferation, and clonogenic potential of GNAQ(mt), but not GNAQ(wt)/BRAF(mt) cells, compared with IR alone.
24470488 Melanocytes use an ultraviolet radiation phototransduction mechanism involving the GNAQ cascade.
24299002 observations support the concept of a functional activation-dependent p63RhoGEF-Galphaq-RGS2 complex
24141786 Metastatic uveal melanoma with GNAQ or GNA11 mutations is responsive to PKC inhibitors.
23993961 These results showed that Fhit was up-regulated specifically by activating Galpha subunits of the Gq subfamily but not by those of the other G protein subfamilies.
23884432 Signaling efficiency of Galphaq through its effectors p63RhoGEF and GEFT depends on their subcellular location.
23778528 GNAQ and GNA11 mutations are, in equal matter, not associated with uveal melanoma patient outcome.
23685997 GNAQ mutations are present in uveal melanocytomas and in a case of transformation to melanoma, implicating GNAQ-dependent mitogen activation signals, in the pathogenesis of uveal melanocytoma.
23665327 The ubiquitination of Galphai2 and Galphaq is suppressed by expression of Ric-8A. The suppression likely requires Ric-8A interaction with these Galpha proteins; the C-terminal truncation of Galphaq and Galphai2 completely abrogates their interaction with Ric-8A.
23656586 The Sturge-Weber syndrome and port-wine stains are caused by a somatic activating mutation in GNAQ. This finding confirms a long-standing hypothesis.
23634288 Mutant alleles of the GNA11 or GNAQ genes, which are highly specific for uveal melanoma, were identified in cell-free DNA of 9 of 22 (41%) patients.
23599145 This study identifies HRAS mutations in deep penetrating nevi. The presence of HRAS mutations and absence of GNAQ or GNA11 mutations in deep penetrating nevi suggests classification of these nevi within the Spitz rather than the blue nevus category.
23572156 Letter/Case Report: oncogenic GNAQ mutation in congenital choroidal melanoma.
23572068 Letter/Case Report: role of GNAQ/GNA11 mutational analysis in management of choroidal melanoma metastatic to the contralateral orbit.
23315865 the GNAQ promoter polymorphism is not a genetic risk factor for rheumatoid arthritis in the Han Chinese population.
23159116 V600E point mutation was identified in the BRAF gene in 3 intramucosal nevi and in 2 melanomas. Only 1 blue nevus harbored the GNAQ209 mutation
23066026 Src family kinases, PI3 kinase and protein kinase C synergize to mediate Gq-dependent platelet activation
22977135 The vast majority of primary large uveal melanomas harbor mutually-exclusive mutations in GNAQ or GNA11, but very rarely have the oncogenic mutations that are reported commonly in other cancers.
22905097 gamma-synuclein has a role in promoting a more robust G protein Galphaq activation of PLCbeta2
22758774 In primary melanocytic tumours of the CNS, GNA11 and N-RAS mutations represent a mechanism of MAPK pathway activation alternative to the common GNAQ mutations
22710260 analysis of molecular complexes of Gq/11alpha protein in HEK293 cells
22701657 Vesicle-associated Galphaq/11 is required for the turnover of LFA-1 adhesion that is necessary for immune cell migration.
22307269 THe results expand the spectrum of GNAQ mutations that may occur in melanocytomas.
22056876 a novel paradigm in which a fraction of the cellular RARalpha pool is present in membrane lipid rafts, where it forms complexes with G protein alpha Q (Galphaq) in response to RA
21945171 The DNA obtained is of sufficient quality to carry out genotyping for markers on chromosome 3, 6 and 8, as well as screening for somatic mutations in GNAQ and GNA11 genes.
21940795 WDR36 acts as a scaffold protein tethering a G-protein-coupled receptor, Galphaq and phospholipase C beta 2 in a signalling complex
21923740 Gaq controls the apoptosis of rheumatoid arthritis peripheral blood lymphocytes through regulating the activity of Mcl-1 and caspase-3.
21592972 Negative regulation of Gq-mediated pathways in platelets by G(12/13) pathways through Fyn kinase
21515378 ET1 stimulated calcium response depends on phospholipase C and is likely mediated through the G-ALPHA-q signaling pathway.
21487925 We did not find any mutation in the GNAQ, AKT3, and PIK3R1 genes in various types of thyroid cancer.
21464134 Regulation of the epithelial Na+ channel by the RH domain of G protein-coupled receptor kinase, GRK2, and Galphaq/11.
21366456 Benign and malignant blue nevi harbor frequent mutations in the Galphaq class of G-protein alpha subunits, Gnaq and Gna11 proteins.
21304157 Studies indicate that the complex between the effector protein phospholipase C-beta3 (PLC-beta3) and its activator, Galpha(q), suggests that several effectors independently evolved a structurally similar helix-turn-helix segment for G protein recognition.
21083380 Of the uveal melanomas we analyzed, 83% had somatic mutations in GNAQ or GNA11.
21083380 Observational study of gene-disease association. (HuGE Navigator)
21072599 results exclude GNAQ as a candidate gene in uveal melanoma patients with a high risk for hereditary cancer predisposition
21056896 presence of GNAQ mutations in the amelanotic/hypomelanotic blue nevus indicates mechanisms underlying pigment homeostasis in this variant appear to be similar to those of its melanotic counterpart
20865267 A detailed analysis of morphology combined with GNAQ mutational analysis aids in the differential diagnosis of melanotic schwannoma with leptomeningeal melanocytic lesions.
20805136 The cases harbouring the GNAQ mutation did not differ significantly in the expression of ERK1/2 and pERK1/2 or in the expression of proliferation markers from cases without the mutation.
20714830 GNAq mutations seem not to play an important role in the development of thyroid follicular neoplasms
20664004 Basic amino acids in the amino-terminus of alpha(q) can affect its lateral segregation on plasma membranes; changes in such lateral segregation may be responsible for the observed signaling defects of alphaq4Q.
20631239 The lack of GNAQ mutations in conjunctival melanocytic lesions suggests the involvement of a different tumorigenic pathway from that of uveal melanoma.
20631239 Observational study of gene-disease association. (HuGE Navigator)
20590159 possibility of ligand-free constitutive TBXA2R signaling through Galphaq binding
20562673 GNAQ promoter diplotypes are associated with insulin resistance and obesity in polycystic ovary syndrome.
20562673 Observational study of gene-disease association. (HuGE Navigator)
20399743 activation of Galphaq weakened the kinase activity of GSK-3beta and enhanced cellular accumulation of beta-Catenin.
20379146 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237586 Increased activation of the Galphaq protein alters eNOS protein expression and phosphorylation only in transgenic males.
20007712 Data show that activation of PLCbeta(2) by alpha(q) and beta1gamma2 differ from activation by Rac2 and from each other.
19936769 GNAQ-dependent mitogen-activated kinase signaling is a promising therapeutic target in melanocytic neoplasms
19903011 The [Ca2+] response is induced by glucagon mainly via the coupling of GCGR to the Galphaq/11 and Galphai/o proteins.
19718445 data indicate that the occurrence of GNAQ mutations display a unique pattern being present in a subset of melanocytic tumors but not in malignancies of glial, epithelial and stromal origin analyzed in this study
19654573 The GNAQ mutation status is not suitable to predict DFS. However, the high frequency of GNAQ mutations may render it a promising target for therapeutic intervention.
19654573 Observational study of gene-disease association. (HuGE Navigator)
19551532 Observational study of gene-disease association. (HuGE Navigator)
19445628 GNAQ hotspot mutations may not have a role in papillary thyroid carcinomas
19426503 knockdown of Galphaq significantly enhanced basal migration in T cells and reduced CXCL12-induced SHP-1 phosphorylation
19332487 In the vascular endothelium, G alpha(q/11)-PECAM-1 forms a mechanosensitive complex which localization suggests the G alpha(q/11)-PECAM-1 complex is a critical mediator of vascular diseases.
19078957 frequent somatic mutations in the heterotrimeric G protein alpha-subunit, GNAQ, in blue naevi (83%) and ocular melanoma of the uvea (46%)
19074441 Abeta induces the formation of cross-linked AT2 oligomers that contribute to the dysfunction of Galphaq/11 in an animal model of Alzheimer disease.
19074439 AT2 oligomers inducing Galphaq/11 arrest are causally involved in inducing symptoms of neurodegeneration
18991294 a role of Galphaq in the fine-tuning of proximal TCR signals at the level of Lck and a negative regulatory role of Galphaq in transcriptional activation of cytokine responses.
18989526 Report phorbol 12-myristate 13-acetate responsive sequence in Galphaq promoter during megakaryocytic differentiation. Regulation by EGR-1 and MAP kinase pathway.
18851832 MLK3 functions in a regulated way to limit levels of the activated GTPase Rho by binding to the Rho activator, p63RhoGEF/GEFT, which, in turn, prevents its activation by Galphaq.
18719078 GNAQ mutations occur in about half of uveal melanomas, representing the most common known oncogenic mutation in this cancer.
18632858 We show that Env-mediated Rac-1 activation is dependent on the activation of Galpha(q) and its downstream targets.
18514160 Observational study of gene-disease association. (HuGE Navigator)
18434368 IGF-II/mannose-6-phosphate receptor signaling induced cell hypertrophy and atrial natriuretic peptide/BNP expression via Galphaq interaction and protein kinase C-alpha/CaMKII activation in H9c2 cardiomyoblast cells.
18424071 These novel data demonstrate an IKK2-dependent, predominantly G-protein-independent pathway involved in PAR-2 regulation of NFkappaB phosphorylation in keratinocytes.
18326504 A novel polymorphism in the Gq promoter region is associated with enhanced promoter activity, Gq expression, intracellular signal transduction, and increased prevalence of left ventricular hypertrophy, particularly in women.
18322150 The M(1) receptor is the predominant mAChR subtype coupling to the Galpha(q/11) G protein in the cerebral cortex.
18096806 the crystal structure of the Galphaq-p63RhoGEF-RhoA complex, detailing the interactions of Galphaq with the Dbl and pleckstrin homology (DH and PH) domains of p63RhoGEF was determined
17720980 Observational study of gene-disease association. (HuGE Navigator)
17720980 Polymorphism of the Galphaq gene is associated with accelerated mortality in heart failure
17606614 Galphaq directly activates p63RhoGEF and Trio via a conserved extension of the Dbl homology-associated pleckstrin homology domain
17552882 Solubilization of this class of Galpha proteins was observed after prolonged agonist stimulation, induced by ultra high concentration of hormone and in cells expressing a large number of GPCRs, revealing tight binding of G(q)alpha protein to the membrane.
17535809 two distinct regions of the Cav3.3 channel are necessary and sufficient for complete M1 receptor-mediated channel inhibition
17307333 These lines of evidence suggested that a Gq-coupled receptor activates specifically p38 MAPK through lipid rafts and Src kinase activation, in which flotillins positively modulate the Gq signaling.
17197445 Galphaq activation of TRPC6 signals the activation of PKCalpha, and thereby induces RhoA activity and endothelial cell contraction
16995904 GTP-Binding Protein alpha Subunits, Gq-G11, gene is regulated during megakaryocytic differentiation by early growth response 1 transcription factor.
16893886 Contractile dysfunction and pathological structural changes in the myocardium of Galpha(q) transgenic mice improve significantly after termination of the Galpha(q) signal, even in animals with overt heart failure.
16860758 alternative pathway operates in the absence of Lck-dependent tyrosine-phosphorylation events and was initiated by the T cell receptor-dependent activation of raft-enriched heterotrimeric Galpha11 proteins
16650966 Our results support a novel model where activated Galpha(q) forms molecular complexes with ARNO and ARF6, possibly through a direct interaction with ARNO, leading to ARF6 activation.
16481068 Quantitative analysis indicated that Galpha(q/11) subunits are abundant polypeptides in human brain, with values ranging from about 1200 ng/mg in cerebral cortex to close to 900 ng/mg of membrane protein in caudate
16218966 Results suggest that the G(q) class proteins are degraded through the proteasome pathway and that cellular localization and/or other protein interactions determine their stability.
16038796 Alpha-betagamma binding is necessary at a point downstream from receptor activation of the heterotrimeric G protein for signal transduction by alpha q.
15794946 Galphaq potentiation of AC9 activity involves Ca2+/calmodulin and CaMKII.
15698833 PKC epsilon and delta are the main PKC isozymes involved in G alpha(q)-mediated signaling in human atria
15694379 These data indicate that the preserved integrity of plasma membrane domains/caveolae is required for complete agonist-induced phosphorylation of G(q)/G(11)alpha.
15611106 beta-Arrestin 1 and Galphaq/11 have roles in activating RhoA and stress fiber formation following receptor stimulation
15471870 analysis of the GRK2 binding site of Galphaq
15466861 PC1 signaling elevates intracellular Ca(2+), activates Galpha(q) and PLC, which then activates calcineurin and NFAT
15383626 (HEK) 293 cells expressing recombinant Galpha(q/11)-coupled muscarinic M3 receptors showed transient coexpression of RGS proteins
15115661 the co-operative effect between Gbetagamma-mediated signaling and the increased intracellular Ca(2+) level represents a robust mechanism for the stimulation of JNK by G(q)-coupled receptors
14617636 G alpha q and platelet activating factor receptor lead to stimulation of Src and focal adhesion kinase in vascular endothelium
14561750 Gq-coupled receptors activate glycogen synthase kinase-3beta and C-terminal Src kinase
12807915 G protein-coupled receptors might evoke G alpha and G beta gamma to orchestrate regulation of phospholipase signaling by tubulin dimers and control of cell shape by microtubules
12714438 The rapid, shear-induced activation of Ras is mediated by Galpha(q) through the activity of Gbetagamma subunits in human vascular endothelial cells.
12704201 agonist binding to Gq-coupled receptors blocks Akt activation via the release of active Galphaq subunits that inhibit phosphatidylinositol 3-kinase
12670961 Gq/11 proteins mediate KDR tyrosine phosphorylation and KDR-mediated HUVEC proliferation through interaction with KDR.
12626493 Galpha protein signaling can lead to internalization of GPCRs, with specificity in both the Galpha proteins and GPCRs that are involved
12193606 regulation of signaling by ezrin-radixin-moesin-binding phosphoprotein-50
12016230 existence of a novel molecular mechanism by which Galpha(q) and the large family of G(q)-coupled receptors can regulate the activity of Rho and its downstream signaling pathways
11848441 A hemorrhagic diathesis patient has a defect in Galphaq gene expression in platelets but not neutrophils, possibly due to defects in transcriptional regulation or mRNA stability, and suggest a hematopoietic-lineage specific defect.
11686331 The increase in Gqalpha and Gialpha1/2 expression was accompanied by an increase in Ca2+ signaling triggered by thrombin and other agonists known to signal to Ca2+ via these G-proteins in platelets.

AA Sequence

MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDE      1 - 70
DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPG     71 - 140
IQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQR    141 - 210
SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE    211 - 280
EKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ    281 - 350
LNLKEYNLV                                                                 351 - 359
//

Text Mined References (196)

PMID Year Title
27265506 2016 ARF6 Is an Actionable Node that Orchestrates Oncogenic GNAQ Signaling in Uveal Melanoma.
27058448 2016 Somatic Activating Mutations in GNAQ and GNA11 Are Associated with Congenital Hemangioma.
26887939 2016 Protein Kinase C ? Interacts with a Novel Binding Region of G?q to Act as a Functional Effector.
26865629 2016 Human Neuropeptide S Receptor Is Activated via a G?q Protein-biased Signaling Cascade by a Human Neuropeptide S Analog Lacking the C-terminal 10 Residues.
26778290 2016 Mosaic Activating Mutations in GNA11 and GNAQ Are Associated with Phakomatosis Pigmentovascularis and Extensive Dermal Melanocytosis.
26775782 2016 The somatic GNAQ mutation (R183Q) is primarily located within the blood vessels of port wine stains.
26368812 2015 Distribution of GNAQ and GNA11 Mutation Signatures in Uveal Melanoma Points to a Light Dependent Mutation Mechanism.
26192947 2015 Genetic Variants Associated with Port-Wine Stains.
25955651 2015 Mutant GNAQ promotes cell viability and migration of uveal melanoma cells through the activation of Notch signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25732870 2015 G?q controls rheumatoid arthritis via regulation of Th17 differentiation.
25695059 2015 Low mutational burden of eight genes involved in the MAPK/ERK, PI3K/AKT, and GNAQ/11 pathways in female genital tract primary melanomas.
25653058 2015 Detection of GNAQ mutations and reduction of cell viability in uveal melanoma cells with functionalized gold nanoparticles.
25433904 2015 Altered glutamate protein co-expression network topology linked to spine loss in the auditory cortex of schizophrenia.
25420509 2014 Diacylglycerol mediates regulation of TASK potassium channels by Gq-coupled receptors.
25374402 2014 The somatic GNAQ mutation c.548G>A (p.R183Q) is consistently found in Sturge-Weber syndrome.
25363280 2014 Frequencies of KIT and GNAQ mutations in acral melanoma.
25316767 2015 Influence of g?q on the dynamics of m3-acetylcholine receptor-g-protein-coupled receptor kinase 2 interaction.
25304237 2014 GNAQ and GNA11 mutations in uveal melanoma.
25280020 2014 Oncogenic GNAQ and GNA11 mutations in uveal melanoma in Chinese.
24970262 2014 Chromosome 3 status combined with BAP1 and EIF1AX mutation profiles are associated with metastasis in uveal melanoma.
24927141 2014 Exome sequencing reveals the likely involvement of SOX10 in uveal melanoma.
24882515 2014 Hippo-independent activation of YAP by the GNAQ uveal melanoma oncogene through a trio-regulated rho GTPase signaling circuitry.
24595385 2014 Protein kinase C inhibitors sensitize GNAQ mutant uveal melanoma cells to ionizing radiation.
24470488 2014 UV light activates a G?q/11-coupled phototransduction pathway in human melanocytes.
24299002 2014 Dynamics of G?q-protein-p63RhoGEF interaction and its regulation by RGS2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141786 2014 Combined PKC and MEK inhibition in uveal melanoma with GNAQ and GNA11 mutations.
24141704 2013 A bacterial toxin catalyzing tyrosine glycosylation of Rho and deamidation of Gq and Gi proteins.
23993961 2013 Activation of G?q subunits up-regulates the expression of the tumor suppressor Fhit.
23884432 2013 Signaling efficiency of G?q through its effectors p63RhoGEF and GEFT depends on their subcellular location.
23778528 2013 Patient survival in uveal melanoma is not affected by oncogenic mutations in GNAQ and GNA11.
23685997 2013 Immunohistochemical and molecular pathology of ocular uveal melanocytoma: evidence for somatic GNAQ mutations.
23665327 2013 Ubiquitination of the heterotrimeric G protein ? subunits G?i2 and G?q is prevented by the guanine nucleotide exchange factor Ric-8A.
23656586 2013 Sturge-Weber syndrome and port-wine stains caused by somatic mutation in GNAQ.
23634288 2013 Ultradeep sequencing detects GNAQ and GNA11 mutations in cell-free DNA from plasma of patients with uveal melanoma.
23599145 2013 Identification of HRAS mutations and absence of GNAQ or GNA11 mutations in deep penetrating nevi.
23572156 2013 Mutation of GNAQ in a cytologically unusual choroidal melanoma in an 18-month-old child.
23572068 2013 Mutational analysis of GNAQ and GNA11 to aid therapy management of a choroidal melanoma metastatic to the contralateral orbit.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23353685 2013 ?-Arrestin-1 directly interacts with G?s and regulates its function.
23315865 2013 G?q gene promoter polymorphisms and rheumatoid arthritis in the Han Chinese population are not associated.
23159116 2012 BRAF and GNAQ mutations in melanocytic tumors of the oral cavity.
23066026 2012 The Src family kinases and protein kinase C synergize to mediate Gq-dependent platelet activation.
22977135 2012 High throughput mass spectrometry-based mutation profiling of primary uveal melanoma.
22905097 2012 ?-Synuclein interacts with phospholipase C?2 to modulate G protein activation.
22758774 2013 GNA11 and N-RAS mutations: alternatives for MAPK pathway activating GNAQ mutations in primary melanocytic tumours of the central nervous system.
22710260 2012 Identification and subcellular localization of molecular complexes of Gq/11? protein in HEK293 cells.
22701657 2012 The G?q/11 proteins contribute to T lymphocyte migration by promoting turnover of integrin LFA-1 through recycling.
22307269 2012 GNAQ and GNA11 mutations in melanocytomas of the central nervous system.
22253748 2012 The protein kinase C inhibitor enzastaurin exhibits antitumor activity against uveal melanoma.
22056876 2012 A retinoic acid receptor RAR? pool present in membrane lipid rafts forms complexes with G protein ?Q to activate p38MAPK.
21945171 2011 Molecular genetic testing of uveal melanoma from routinely processed and stained cytology specimens.
21940795 2011 WDR36 acts as a scaffold protein tethering a G-protein-coupled receptor, G?q and phospholipase C? in a signalling complex.
21923740 2012 Expression of G protein ?q Subunit is Decreased in Lymphocytes from Patients with Rheumatoid Arthritis and is Correlated with Disease Activity.
21592972 2011 Negative regulation of Gq-mediated pathways in platelets by G(12/13) pathways through Fyn kinase.
21515378 2011 ET-1 induced Elevation of intracellular calcium in clonal neuronal and embryonic kidney cells involves endogenous endothelin-A receptors linked to phospholipase C through G?(q/11).
21487925 2011 Uncommon GNAQ, MMP8, AKT3, EGFR, and PIK3R1 mutations in thyroid cancers.
21464134 2011 Regulation of the epithelial Na+ channel by the RH domain of G protein-coupled receptor kinase, GRK2, and Galphaq/11.
21366456 2011 Blue nevi and variants: an update.
21304157 2011 Galpha(q) and phospholipase C-beta: turn on, turn off, and do it fast.
21269460 2011 Initial characterization of the human central proteome.
21083380 2010 Mutations in GNA11 in uveal melanoma.
21072599 2011 Lack of GNAQ germline mutations in uveal melanoma patients with high risk for hereditary cancer predisposition.
21056896 2011 Somatic mutations in GNAQ in amelanotic/hypomelanotic blue nevi.
20865267 2010 Improved discrimination of melanotic schwannoma from melanocytic lesions by combined morphological and GNAQ mutational analysis.
20805136 2011 Analysis of GNAQ mutations, proliferation and MAPK pathway activation in uveal melanomas.
20714830 2010 GNAq mutations are not identified in papillary thyroid carcinomas and hyperfunctioning thyroid nodules.
20664004 2010 An N-terminal polybasic motif of G?q is required for signaling and influences membrane nanodomain distribution.
20631239 2010 Lack of oncogenic GNAQ mutations in melanocytic lesions of the conjunctiva as compared to uveal melanoma.
20590159 2010 Structural and functional analysis of the C-terminus of Galphaq in complex with the human thromboxane A2 receptor provides evidence of constitutive activity.
20562673 2010 A functional GNAQ promoter haplotype is associated with altered Gq expression and with insulin resistance and obesity in women with polycystic ovary syndrome.
20399743 2010 Regulation of GSK-3beta and beta-Catenin by Galphaq in HEK293T cells.
20379146 2010 Biological pathway-based genome-wide association analysis identified the vasoactive intestinal peptide (VIP) pathway important for obesity.
20237586 2010 eNOS phosphorylation and translocation are altered in male but not female mice by increased activation of the G?q protein.
20007712 2010 Differential regulation of phospholipase C-beta2 activity and membrane interaction by Galphaq, Gbeta1gamma2, and Rac2.
19936769 2010 Activating mutations of the GNAQ gene: a frequent event in primary melanocytic neoplasms of the central nervous system.
19903011 2009 Glucagon receptor mediates calcium signaling by coupling to G alpha q/11 and G alpha i/o in HEK293 cells.
19718445 2009 Mutational profile of GNAQQ209 in human tumors.
19654573 2009 Oncogenic GNAQ mutations are not correlated with disease-free survival in uveal melanoma.
19551532 2009 Somatic mutation of GNAQ gene is rare in common solid cancers and leukemias.
19445628 2009 Lack of GNAQ hotspot mutation in papillary thyroid carcinomas.
19426503 2009 Interplay between the heterotrimeric G-protein subunits Galphaq and Galphai2 sets the threshold for chemotaxis and TCR activation.
19332487 2009 Rapid changes in shear stress induce dissociation of a G alpha(q/11)-platelet endothelial cell adhesion molecule-1 complex.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19078957 2009 Frequent somatic mutations of GNAQ in uveal melanoma and blue naevi.
19074441 2009 Angiotensin II AT2 receptor oligomers mediate G-protein dysfunction in an animal model of Alzheimer disease.
19074439 2009 Dominant negative AT2 receptor oligomers induce G-protein arrest and symptoms of neurodegeneration.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18991294 2008 The heterotrimeric G-protein alpha-subunit Galphaq regulates TCR-mediated immune responses through an Lck-dependent pathway.
18989526 2008 Phorbol 12-myristate 13-acetate (PMA) responsive sequence in Galphaq promoter during megakaryocytic differentiation. Regulation by EGR-1 and MAP kinase pathway.
18936096 2008 Assembly of high order G alpha q-effector complexes with RGS proteins.
18851832 2008 MLK3 limits activated Galphaq signaling to Rho by binding to p63RhoGEF.
18719078 2008 Oncogenic mutations in GNAQ occur early in uveal melanoma.
18672896 2008 Regulation of G protein-coupled receptor activities by the platelet-endothelial cell adhesion molecule, PECAM-1.
18632858 2008 Induction of the Galpha(q) signaling cascade by the human immunodeficiency virus envelope is required for virus entry.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18514160 2008 Phosphodiesterase 8B gene variants are associated with serum TSH levels and thyroid function.
18434368 2008 IGF-II/mannose-6-phosphate receptor signaling induced cell hypertrophy and atrial natriuretic peptide/BNP expression via Galphaq interaction and protein kinase C-alpha/CaMKII activation in H9c2 cardiomyoblast cells.
18424071 2008 G-protein-dependent and -independent pathways regulate proteinase-activated receptor-2 mediated p65 NFkappaB serine 536 phosphorylation in human keratinocytes.
18326504 2008 Characterization of the GNAQ promoter and association of increased Gq expression with cardiac hypertrophy in humans.
18322150 2008 Pharmacological assessment of m1 muscarinic acetylcholine receptor-gq/11 protein coupling in membranes prepared from postmortem human brain tissue.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18096806 2007 Structure of Galphaq-p63RhoGEF-RhoA complex reveals a pathway for the activation of RhoA by GPCRs.
17897319 2007 Integral and associated lysosomal membrane proteins.
17720980 2007 A functional polymorphism of the Galphaq (GNAQ) gene is associated with accelerated mortality in African-American heart failure.
17606614 2007 Galphaq directly activates p63RhoGEF and Trio via a conserved extension of the Dbl homology-associated pleckstrin homology domain.
17552882 2008 The time-course of agonist-induced solubilization of trimeric G(q)alpha/G(11)alpha proteins resolved by two-dimensional electrophoresis.
17535809 2007 Selective inhibition of Cav3.3 T-type calcium channels by Galphaq/11-coupled muscarinic acetylcholine receptors.
17307333 2007 The lipid raft proteins flotillins/reggies interact with Galphaq and are involved in Gq-mediated p38 mitogen-activated protein kinase activation through tyrosine kinase.
17197445 2007 Galphaq-TRPC6-mediated Ca2+ entry induces RhoA activation and resultant endothelial cell shape change in response to thrombin.
16995904 2006 Early growth response transcription factor EGR-1 regulates Galphaq gene in megakaryocytic cells.
16893886 2006 Reversible heart failure in G alpha(q) transgenic mice.
16860758 2006 Bacterial superantigens bypass Lck-dependent T cell receptor signaling by activating a Galpha11-dependent, PLC-beta-mediated pathway.
16650966 2006 ARF6 activation by Galpha q signaling: Galpha q forms molecular complexes with ARNO and ARF6.
16481068 2006 Levels of G-protein alpha q/11 subunits and of phospholipase C-beta(1-4), -gamma, and -delta1 isoforms in postmortem human brain caudate and cortical membranes: potential functional implications.
16381901 2006 The LIFEdb database in 2006.
16218966 2005 Proteasome involvement in the degradation of the G(q) family of Galpha subunits.
16102047 2005 Protease-activated receptors in hemostasis, thrombosis and vascular biology.
16038796 2005 Loss of association between activated Galpha q and Gbetagamma disrupts receptor-dependent and receptor-independent signaling.
15794946 2005 Galphaq potentiation of adenylate cyclase type 9 activity through a Ca2+/calmodulin-dependent pathway.
15698833 2005 G alpha(q)-coupled receptors in human atrium function through protein kinase C epsilon and delta.
15694379 2005 Agonist-induced tyrosine phosphorylation of Gq/G11 alpha requires the intact structure of membrane domains.
15611106 2005 beta-Arrestin 1 and Galphaq/11 coordinately activate RhoA and stress fiber formation following receptor stimulation.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471870 2004 Characterization of the GRK2 binding site of Galphaq.
15466861 2004 Polycystin-1 activates the calcineurin/NFAT (nuclear factor of activated T-cells) signaling pathway.
15383626 2004 Single-cell imaging of intracellular Ca2+ and phospholipase C activity reveals that RGS 2, 3, and 4 differentially regulate signaling via the Galphaq/11-linked muscarinic M3 receptor.
15322542 2004 Effects of G-protein mutations on skin color.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15115661 2004 Gbetagamma signaling and Ca2+ mobilization co-operate synergistically in a Sos and Rac-dependent manner in the activation of JNK by Gq-coupled receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14617636 2004 Activation of platelet-activating factor receptor-coupled G alpha q leads to stimulation of Src and focal adhesion kinase via two separate pathways in human umbilical vein endothelial cells.
14561750 2003 Phospholipase C-independent activation of glycogen synthase kinase-3beta and C-terminal Src kinase by Galphaq.
12885252 2003 Differential interaction of GRK2 with members of the G alpha q family.
12807915 2003 G beta gamma mediates the interplay between tubulin dimers and microtubules in the modulation of Gq signaling.
12714438 2003 Rapid activation of Ras by fluid flow is mediated by Galpha(q) and Gbetagamma subunits of heterotrimeric G proteins in human endothelial cells.
12711604 2003 Functional characterization of human receptors for short chain fatty acids and their role in polymorphonuclear cell activation.
12704201 2003 Activated G alpha q inhibits p110 alpha phosphatidylinositol 3-kinase and Akt.
12670961 2003 Heterotrimeric G alpha q/G alpha 11 proteins function upstream of vascular endothelial growth factor (VEGF) receptor-2 (KDR) phosphorylation in vascular permeability factor/VEGF signaling.
12670932 2003 G beta 5.RGS7 inhibits G alpha q-mediated signaling via a direct protein-protein interaction.
12629551 2003 Free fatty acids regulate insulin secretion from pancreatic beta cells through GPR40.
12626493 2003 Galphaq-coupled receptor internalization specifically induced by Galphaq signaling. Regulation by EBP50.
12496284 2003 The orphan G protein-coupled receptor GPR40 is activated by medium and long chain fatty acids.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12193606 2002 Regulation of GTP-binding protein alpha q (Galpha q) signaling by the ezrin-radixin-moesin-binding phosphoprotein-50 (EBP50).
12016230 2002 Potent activation of RhoA by Galpha q and Gq-coupled receptors.
11955952 2002 Cloning and characterization of a novel regulator of G protein signalling in human platelets.
11916537 Multiplicity of mechanisms of serotonin receptor signal transduction.
11848441 2002 Human platelet Galphaq deficiency is associated with decreased Galphaq gene expression in platelets but not neutrophils.
11812005 2002 Identification of G-proteins coupling to the vasoactive intestinal peptide receptor VPAC(1) using immunoaffinity chromatography: evidence for precoupling.
11753430 2002 A unique fold of phospholipase C-beta mediates dimerization and interaction with G alpha q.
11686331 2001 Biogenesis of G-protein mediated calcium signaling in human megakaryocytes.
11443126 2001 Protein kinase A-mediated phosphorylation of serine 357 of the mouse prostacyclin receptor regulates its coupling to G(s)-, to G(i)-, and to G(q)-coupled effector signaling.
11408001 2001 Analysis of Gq protein alpha subunit mRNA expression in human monocytes: relevance of the purification step.
11278452 2001 Physical and functional interactions of Galphaq with Rho and its exchange factors.
11253162 2001 Characterization of RGS5 in regulation of G protein-coupled receptor signaling.
11194358 2000 Identification of G-protein coupled receptor subunits in normal human dental pulp.
11118617 2000 Cloning and characterization of the human phosphoinositide-specific phospholipase C-beta 1 (PLC beta 1).
11076863 2000 DNA cloning using in vitro site-specific recombination.
10728414 2000 Alterations in Ca2+ cycling proteins and G alpha q signaling after left ventricular assist device support in failing human hearts.
10633085 2000 Interaction of folate receptor with signaling molecules lyn and G(alpha)(i-3) in detergent-resistant complexes from the ovary carcinoma cell line IGROV1.
10598591 1999 A novel spliced variant of the type 1 corticotropin-releasing hormone receptor with a deletion in the seventh transmembrane domain present in the human pregnant term myometrium and fetal membranes.
10550060 1999 Calmodulin dependence of presynaptic metabotropic glutamate receptor signaling.
10488065 1999 Differential coupling of the sphingosine 1-phosphate receptors Edg-1, Edg-3, and H218/Edg-5 to the G(i), G(q), and G(12) families of heterotrimeric G proteins.
10446129 1999 The prostacyclin receptor is isoprenylated. Isoprenylation is required for efficient receptor-effector coupling.
9770463 1998 Identification of the binding site for Gqalpha on its effector Bruton's tyrosine kinase.
9700850 1998 G alpha q cDNA sequence from human platelets.
9685625 1998 Molecular characterization, pharmacological properties and chromosomal localization of the human GALR2 galanin receptor.
9660808 1998 Expression of GTPase-deficient Gialpha2 results in translocation of cytoplasmic RGS4 to the plasma membrane.
9488690 1998 Role of the second and third intracellular loops of metabotropic glutamate receptors in mediating dual signal transduction activation.
9405622 1997 RGS2/G0S8 is a selective inhibitor of Gqalpha function.
9238049 1997 Platelet signal transduction defect with Galpha subunit dysfunction and diminished Galphaq in a patient with abnormal platelet responses.
9198220 1997 Signaling through G proteins in platelets: to the integrins and beyond.
9175863 1997 Interaction of the G-protein G11alpha with receptors and phosphoinositidase C: the contribution of G-protein palmitoylation and membrane association.
9152406 1997 The human thromboxane A2 receptor alpha isoform (TP alpha) functionally couples to the G proteins Gq and G11 in vivo and is activated by the isoprostane 8-epi prostaglandin F2 alpha.
9061052 1997 Expression of G proteins in human placentas from pregnancies complicated by gestational hypertension.
8923415 Expression of angiotensin II type-I receptor and phospholipase C-linked G alpha q/11 protein in the human placenta.
8836152 1996 Specificity of G alpha q and G alpha 11 gene expression in platelets and erythrocytes. Expressions of cellular differentiation and species differences.
8825633 1995 Molecular cloning of human G alpha q cDNA and chromosomal localization of the G alpha q gene (GNAQ) and a processed pseudogene.
8664309 1996 Human G(alpha q): cDNA and tissue distribution.
8655576 1996 Differential distribution of alpha subunits and beta gamma subunits of heterotrimeric G proteins on Golgi membranes of the exocrine pancreas.
8552586 1996 The human thyrotropin receptor: a heptahelical receptor capable of stimulating members of all four G protein families.
8504751 1993 Identification and expression of G-proteins in human myometrium: up-regulation of G alpha s in pregnancy.
8227063 1993 Palmitoylation is required for signaling functions and membrane attachment of Gq alpha and Gs alpha.
8188646 1994 The human thyrotropin receptor activates G-proteins Gs and Gq/11.
7937899 1994 Mechanism of GTP hydrolysis by G-protein alpha subunits.
7791744 1995 Expression of GTP-binding protein alpha subunits in human thymocytes.
7629074 1995 Mapping of single amino acid residues required for selective activation of Gq/11 by the m3 muscarinic acetylcholine receptor.
7492305 1995 Ca2+ signalling in K562 human erythroleukaemia cells: effect of dimethyl sulphoxide and role of G-proteins in thrombin- and thromboxane A2-activated pathways.
2841328 1988 Purification and characterization of membrane-bound phospholipase C specific for phosphoinositides from human platelets.
1851174 1991 The G protein coupled to the thromboxane A2 receptor in human platelets is a member of the novel Gq family.
1333286 1992 Signal-transducing G proteins and antidepressant drugs: evidence for modulation of alpha subunit gene expression in rat brain.
1322796 1992 Phospholipase C-beta 1 is a GTPase-activating protein for Gq/11, its physiologic regulator.