Property Summary

NCBI Gene PubMed Count 75
PubMed Score 158.75
PubTator Score 92.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.700 7.2e-06
astrocytic glioma -1.500 8.1e-03
Astrocytoma, Pilocytic -2.200 5.7e-07
atypical teratoid / rhabdoid tumor -2.700 5.1e-05
colon cancer -2.500 8.1e-08
ependymoma -2.300 6.2e-03
facioscapulohumeral dystrophy 1.500 2.4e-02
glioblastoma -2.900 8.2e-09
group 3 medulloblastoma -2.500 5.0e-04
lung carcinoma 4.100 7.2e-57
medulloblastoma, large-cell -1.900 1.0e-03
oligodendroglioma -1.800 9.2e-17
osteosarcoma 4.467 1.2e-11
ovarian cancer 1.300 3.4e-12
primitive neuroectodermal tumor -1.300 2.0e-02
psoriasis -1.200 1.4e-02
subependymal giant cell astrocytoma -2.271 3.9e-02

Gene RIF (23)

AA Sequence

MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYK      1 - 70
PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQEC     71 - 140
FNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERK    141 - 210
KWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIK    211 - 280
KSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRG    281 - 350
CGLY                                                                      351 - 354
//

Text Mined References (81)

PMID Year Title