Property Summary

NCBI Gene PubMed Count 129
PubMed Score 3.23
PubTator Score 10.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia -1.100 4.7e-02
adult high grade glioma -1.300 2.1e-03
astrocytoma -1.200 8.6e-08
atypical teratoid / rhabdoid tumor -2.400 4.4e-04
Breast cancer -1.200 8.6e-04
breast carcinoma -1.500 5.6e-04
colon cancer -1.200 4.2e-02
ductal carcinoma in situ -2.300 3.4e-04
fibroadenoma -1.800 1.9e-02
glioblastoma -1.400 1.1e-04
group 3 medulloblastoma -1.100 3.4e-02
interstitial cystitis -1.100 1.3e-02
invasive ductal carcinoma -2.500 1.8e-03
medulloblastoma, large-cell -1.700 1.8e-06
oligodendroglioma -1.100 1.3e-05
ovarian cancer -2.900 1.1e-08
pancreatic cancer 1.300 1.1e-03
Pick disease -1.200 1.1e-02
primary pancreatic ductal adenocarcinoma 1.202 2.5e-03
subependymal giant cell astrocytoma -2.038 6.3e-03

 IMPC Phenotype (1)

Protein-protein Interaction (12)

Gene RIF (62)

AA Sequence

MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYK      1 - 70
AVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACF     71 - 140
NRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKK    141 - 210
WIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKK    211 - 280
SPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKD    281 - 350
CGLF                                                                      351 - 354
//

Text Mined References (140)

PMID Year Title