Property Summary

NCBI Gene PubMed Count 44
PubMed Score 475.03
PubTator Score 67.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
esophageal adenocarcinoma -2.500 2.3e-02
psoriasis 3.100 1.8e-05
group 4 medulloblastoma -1.800 2.3e-06
atypical teratoid / rhabdoid tumor -1.200 1.6e-04
medulloblastoma, large-cell -1.500 2.7e-03
primitive neuroectodermal tumor -1.300 2.3e-03
tuberculosis -1.300 3.0e-04
pancreatic ductal adenocarcinoma liver m... 1.110 3.9e-02
active Crohn's disease 1.914 2.4e-02
active ulcerative colitis 2.307 4.4e-03
pancreatic cancer 1.200 1.3e-04
lung carcinoma -1.900 1.6e-22
ovarian cancer 1.500 2.6e-04

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (14)

PMID Text
25701539 GNA15 was not expressed in normal neuroendocrine cells but was overexpressed in gastroenteropancreatic neuroendocrine neoplasia cell lines.
24204697 Data indicate the importance of Galpha16 as a downstream effector of the non-canonical Wnt signaling pathway and as a potential therapeutic target for the treatment of non small cell lung cancer.
23200847 G15 ectopic presence could functionally contribute to the transformation process since siRNA-induced depletion of Galpha15 in pancreatic carcinoma cell lines dramatically inhibited anchorage-independent growth and resistance to the lack of nutrients.
22227248 This paper shows how G alpha 15 and other Gq class members phosphorylate PKD in differing patterns
21486497 beta3 region of Galpha16 is essential for interaction with TPR1 and the subsequent activation of Ras
20150327 This review summarizes the specific features that distinguish Galpha15/GNA15 (G15 alpha subunit) from all other alpha subunits of the Gq class. G15 is a heterotrimeric G protein complex that is named after its alpha subunit.
19687291 The ability of CCR1 to signal through Galpha(14/16) thus provides a linkage for chemokines to regulate NF-kappaB-dependent responses.
19275934 The paper describes G alpha 15 resistance to arrestin-desensitization making it differ from other heterotrimeric G proteins (Gq, Gs, Gi, G12/13 class)
18755267 Co-stimulation of G(s) and G(q) can result in the fine-tuning of STAT3 activation status, and this may provide the basis for cell type-specific responses following activation of hIP.
16218966 Results suggest that the G(q) class proteins are degraded through the proteasome pathway and that cellular localization and/or other protein interactions determine their stability.
14551213 Galpha16 stimulates STAT3 via a c-Src/JAK- and ERK-dependent mechanism
12670499 G protein-coupled receptors activate STAT3 via G alpha(16), a G alpha subunit which is primarily expressed in hematopoietic cells.
12095632 role of intracellular loops of cannabinoid CB1 receptor in functional interaction with Galpha16.
11686331 Megakaryocytopoiesis was accompanied by down-regulation of the 43 kDa and 46 kDa variants of G16alpha, constant expression of Gsalpha, and up-regulation of Gqalpha and Gialpha1/2.

AA Sequence

MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIKQMRIIHGAGY      1 - 70
SEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQDPYKVTTFEKRYAAAMQWLWR     71 - 140
DAGIRAYYERRREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQKTNLRIVDVG    141 - 210
GQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTD    211 - 280
ILEEKIPTSHLATYFPSFQGPKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQ    281 - 350
NIRKVFKDVRDSVLARYLDEINLL                                                  351 - 374
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25701539 2015 GNA15 expression in small intestinal neuroendocrine neoplasia: functional and signalling pathway analyses.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24204697 2013 Heterotrimeric G-protein, G?16, is a critical downstream effector of non-canonical Wnt signaling and a potent inhibitor of transformed cell growth in non small cell lung cancer.
23200847 2013 Ectopic expression of the heterotrimeric G15 protein in pancreatic carcinoma and its potential in cancer signal transduction.
22227248 2012 Differential PKC-dependent and -independent PKD activation by G protein ? subunits of the Gq family: selective stimulation of PKD Ser??? autophosphorylation by G?q.
21486497 2011 G?16 interacts with tetratricopeptide repeat 1 (TPR1) through its ?3 region to activate Ras independently of phospholipase C? signaling.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
20445134 2010 Association of genome-wide variation with the risk of incident heart failure in adults of European and African ancestry: a prospective meta-analysis from the cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
20150327 2010 The puzzling uniqueness of the heterotrimeric G15 protein and its potential beyond hematopoiesis.
19687291 2009 CCR1-mediated activation of Nuclear Factor-kappaB in THP-1 monocytic cells involves Pertussis Toxin-insensitive Galpha(14) and Galpha(16) signaling cascades.
19275934 2009 Heterotrimeric G proteins demonstrate differential sensitivity to beta-arrestin dependent desensitization.
18755267 2008 Prostacyclin receptor-induced STAT3 phosphorylation in human erythroleukemia cells is mediated via Galpha(s) and Galpha(16) hybrid signaling.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16218966 2005 Proteasome involvement in the degradation of the G(q) family of Galpha subunits.
16102047 2005 Protease-activated receptors in hemostasis, thrombosis and vascular biology.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14551213 2003 Constitutively active Galpha16 stimulates STAT3 via a c-Src/JAK- and ERK-dependent mechanism.
14535952 2003 The first and third intracellular loops together with the carboxy terminal tail of the delta-opioid receptor contribute toward functional interaction with Galpha16.
12885252 2003 Differential interaction of GRK2 with members of the G alpha q family.
12748287 2003 Identification of tetratricopeptide repeat 1 as an adaptor protein that interacts with heterotrimeric G proteins and the small GTPase Ras.
12670499 2003 Regulation of STAT3 activity by G16-coupled receptors.
12647293 2003 Regulation of hematopoietic-specific G-protein Galpha15 and Galpha16 by protein kinase C.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12401211 2002 Tandem genomic arrangement of a G protein (Gna15) and G protein-coupled receptor (s1p(4)/lp(C1)/Edg6) gene.
12095632 2002 Role of intracellular loops of cannabinoid CB(1) receptor in functional interaction with G(alpha16).
11686331 2001 Biogenesis of G-protein mediated calcium signaling in human megakaryocytes.
11118617 2000 Cloning and characterization of the human phosphoinositide-specific phospholipase C-beta 1 (PLC beta 1).
10973974 2000 Molecular cloning and characterization of a novel type of histamine receptor preferentially expressed in leukocytes.
10644723 2000 PAR1 thrombin receptor-G protein interactions. Separation of binding and coupling determinants in the galpha subunit.
10571060 1999 Cloning and characterization of a rabbit ortholog of human Galpha16 and mouse G(alpha)15.
9988720 1999 Functional regulation of Galpha16 by protein kinase C.
9843397 1998 Interleukin-8 receptors R1 and R2 activate mitogen-activated protein kinases and induce c-fos, independent of Ras and Raf-1 in Chinese hamster ovary cells.
9742207 1998 Signalling through the leukotriene B4 receptor involves both alphai and alpha16, but not alphaq or alpha11 G-protein subunits.
9572309 1998 Differential coupling of mu-, delta-, and kappa-opioid receptors to G alpha16-mediated stimulation of phospholipase C.
8863838 1996 Coupling of metabotropic glutamate receptors 2 and 4 to G alpha 15, G alpha 16, and chimeric G alpha q/i proteins: characterization of new antagonists.
8415674 1993 Purification and characterization of recombinant G16 alpha from Sf9 cells: activation of purified phospholipase C isozymes by G-protein alpha subunits.
7937899 1994 Mechanism of GTP hydrolysis by G-protein alpha subunits.
7797501 1995 G alpha 15 and G alpha 16 couple a wide variety of receptors to phospholipase C.
7703490 1995 G protein subunit G alpha 16 expression is restricted to progenitor B cells during human B-cell differentiation.
7608160 1995 Selective coupling of beta 2-adrenergic receptor to hematopoietic-specific G proteins.
1905813 1991 G alpha 16, a G protein alpha subunit specifically expressed in hematopoietic cells.
1322796 1992 Phospholipase C-beta 1 is a GTPase-activating protein for Gq/11, its physiologic regulator.
1302014 1992 Evolution of the mammalian G protein alpha subunit multigene family.