Property Summary

NCBI Gene PubMed Count 26
PubMed Score 4.34
PubTator Score 12.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
urothelial carcinoma -2.700 4.9e-04
astrocytic glioma -1.300 1.0e-02
ependymoma -1.800 4.7e-03
oligodendroglioma -1.600 3.2e-03
group 3 medulloblastoma -2.100 3.7e-03
medulloblastoma, large-cell -1.100 2.4e-02
primitive neuroectodermal tumor -1.100 4.3e-02
non-small cell lung cancer -1.038 7.0e-09
colon cancer -1.100 9.5e-03
lung cancer -1.600 2.9e-04
active Crohn's disease 1.634 1.3e-03
active ulcerative colitis 1.492 9.7e-03
lung carcinoma -2.600 3.5e-19
pituitary cancer -1.200 4.2e-02

Gene RIF (10)

PMID Text
26377666 Study suggests that the previously identified PLCbeta-interacting residues are insufficient to ensure productive interaction of Galpha14 with PLCbeta, while an intact N-terminal half of Galpha14 is apparently required for PLCbeta interaction.
23975421 TNF-alpha/TNFR1 signaling promotes gastric tumorigenesis through induction of Noxo1 and Gna14 in tumor cells.
22711498 TPR1 is required for Galpha14 to stimulate Ras-dependent signaling pathways, but not for the propagation of signals along Ras-independent pathways.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19687291 The ability of CCR1 to signal through Galpha(14/16) thus provides a linkage for chemokines to regulate NF-kappaB-dependent responses.
18360038 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17620339 G14alpha and G16alpha are palmitoylated at distinct polycysteine sequences, and that the adjacent polybasic domain is not required for Galpha palmitoylation but is important for localization and functional activity of heterotrimeric G proteins
16115892 activation of the IKK/NFkappaB signaling cascade by SSTR2 requires a complicated network consisting of Galpha(14), protein kinase C, CamkII, ERK, and c-Src

AA Sequence

MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKG      1 - 70
FTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQEC     71 - 140
YDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERR    141 - 210
KWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIM    211 - 280
YSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLR    281 - 350
EFNLV                                                                     351 - 355
//

Text Mined References (28)

PMID Year Title
26377666 2015 An intact helical domain is required for G?14 to stimulate phospholipase C?.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23975421 2014 TNF-?/TNFR1 signaling promotes gastric tumorigenesis through induction of Noxo1 and Gna14 in tumor cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
22711498 2012 Activation of Ras-dependent signaling pathways by G(14) -coupled receptors requires the adaptor protein TPR1.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19687291 2009 CCR1-mediated activation of Nuclear Factor-kappaB in THP-1 monocytic cells involves Pertussis Toxin-insensitive Galpha(14) and Galpha(16) signaling cascades.
18360038 2008 Identification of hypertension-susceptibility genes and pathways by a systemic multiple candidate gene approach: the millennium genome project for hypertension.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17620339 2007 The importance of N-terminal polycysteine and polybasic sequences for G14alpha and G16alpha palmitoylation, plasma membrane localization, and signaling function.
16115892 2005 Activation of nuclear factor {kappa}B by somatostatin type 2 receptor in pancreatic acinar AR42J cells involves G{alpha}14 and multiple signaling components: a mechanism requiring protein kinase C, calmodulin-dependent kinase II, ERK, and c-Src.
16102047 2005 Protease-activated receptors in hemostasis, thrombosis and vascular biology.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11118617 2000 Cloning and characterization of the human phosphoinositide-specific phospholipase C-beta 1 (PLC beta 1).
10644457 1999 The G protein subunit gene families.
10625681 2000 Interaction with Gbetagamma is required for membrane targeting and palmitoylation of Galpha(s) and Galpha(q).
10191087 1999 Genomic organization of the human galpha14 and Galphaq genes and mutation analysis in chorea-acanthocytosis (CHAC).
8982657 1996 Direct evidence for two distinct G proteins coupling with thrombin receptors in human neuroblastoma SH-EP cells.
8626727 1996 Selective G protein coupling by C-C chemokine receptors.
8316840 1993 G protein-coupled signal transduction pathways for interleukin-8.
7937899 1994 Mechanism of GTP hydrolysis by G-protein alpha subunits.
1322796 1992 Phospholipase C-beta 1 is a GTPase-activating protein for Gq/11, its physiologic regulator.