Property Summary

NCBI Gene PubMed Count 85
PubMed Score 9.11
PubTator Score 71.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.300 3.2e-05
osteosarcoma -1.764 9.5e-07
Polycystic ovary syndrome -1.043 2.0e-03
tuberculosis -1.300 6.4e-07

Gene RIF (51)

AA Sequence

MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDALLARERRAVRRLVKILLLGAGESGK      1 - 70
STFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQYSENEKHGMFLMAFENKAGL     71 - 140
PVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKG    141 - 210
IVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETI    211 - 280
VNNKLFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHF    281 - 350
TTAIDTENVRFVFHAVKDTILQENLKDIMLQ                                           351 - 381
//

Text Mined References (88)

PMID Year Title