Property Summary

NCBI Gene PubMed Count 86
PubMed Score 564.23
PubTator Score 83.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis 1.400 4.8e-03
osteosarcoma 2.829 2.0e-05
astrocytoma 1.200 1.2e-02
atypical teratoid / rhabdoid tumor -1.500 5.8e-07
medulloblastoma, large-cell -1.600 5.8e-05
primitive neuroectodermal tumor -1.100 2.0e-03
colon cancer -1.100 1.2e-02
adult high grade glioma -1.200 6.0e-04
subependymal giant cell astrocytoma -1.610 2.1e-02
spina bifida -1.234 3.5e-02
ulcerative colitis -1.400 1.1e-05
ovarian cancer 2.100 2.9e-05

Gene RIF (48)

PMID Text
26994139 These findings demonstrate that CaSR-targeted compounds can rectify signaling disturbances caused by germline and somatic Galpha11 mutations, which respectively lead to calcium disorders and tumorigenesis; and that ADH2-causing Galpha11 mutations induce non-constitutive alterations in MAPK signaling.
26778290 extensive dermal melanocytosis and phakomatosis pigmentovascularis are associated with activating mutations in GNA11 and GNAQ, genes that encode Galpha subunits of heterotrimeric G proteins
26645730 Melanomas associated with blue nevi or mimicking cellular blue nevi commonly have GNA11 mutations.
26462151 Mutations in GNA11 gene is associated with malignant uveal melanoma.
26368812 Distribution of GNAQ and GNA11 Mutation Signatures in Uveal Melanoma Points to a Light Dependent Mutation Mechanism.
26100877 Data show that N-linked glycosylation of protease-activated receptor-1 (PAR1) at extracellular loop 2 (ECL2) controls G12/13 versus Gq G-proteins coupling specificity in response to thrombin stimulation.
25934394 Identification of Distinct Conformations of the Angiotensin-II Type 1 Receptor Associated with the Gq/11 Protein Pathway and the beta-Arrestin Pathway Using Molecular Dynamics Simulations.
25695059 Involved in the MAPK/ERK, PI3K/AKT, and GNAQ/11 pathways.
25304237 review discusses the multiple activated signaling targets downstream of mutant GNAQ and GNA11 in uveal melanoma, including MEK, PI3-kinase/Akt, protein kinase C, and YAP
25280020 Oncogenic GNA11 mutation is associated with uveal melanoma.
24970262 There was a significant association of GNA11 mutation status with metastatic status in uveal melanoma.
24823460 Our findings indicate that the germline gain-of-function mutation of GNA11 is a cause of autosomal dominant hypoparathyroidism and implicate a novel role for GNA11 in skeletal growth.
24576953 melanopsin is a powerful optogenetic tool for the investigation of spatial and temporal aspects of Gq signalling in cardiovascular research
24497640 the PECAM-1.Galphaq/11 mechanosensitive complex contains an endogenous heparan sulfate proteoglycan with HS chains that is critical for junctional complex assembly and regulating the flow response
24308950 Increasing Galpha11 protein expression in osteoblasts can alter gene expression and result in a dual mechanism of trabecular bone loss.
24141786 Metastatic uveal melanoma with GNAQ or GNA11 mutations is responsive to PKC inhibitors.
23802749 There is a specific Egr-1 binding site at nt-475/-445. Egr-1 evoked an increased GNA11 transcription.
23802536 Genomewide linkage analysis, combined with whole-exome sequencing, revealed two different heterozygous mutations affecting Galpha11 as novel causes of autosomal dominant isolated hypoparathyroidism.
23802516 Galpha11 mutants with loss of function cause familial hypocalciuric hypercalcemia type 2, and Galpha11 mutants with gain of function cause a clinical disorder designated as autosomal dominant hypocalcemia type 2.
23778528 GNAQ and GNA11 mutations are, in equal matter, not associated with uveal melanoma patient outcome.
23634288 Mutant alleles of the GNA11 or GNAQ genes, which are highly specific for uveal melanoma, were identified in cell-free DNA of 9 of 22 (41%) patients.
23599145 This study identifies HRAS mutations in deep penetrating nevi. The presence of HRAS mutations and absence of GNAQ or GNA11 mutations in deep penetrating nevi suggests classification of these nevi within the Spitz rather than the blue nevus category.
23572068 Letter/Case Report: role of GNAQ/GNA11 mutational analysis in management of choroidal melanoma metastatic to the contralateral orbit.
22977135 The vast majority of primary large uveal melanomas harbor mutually-exclusive mutations in GNAQ or GNA11, but very rarely have the oncogenic mutations that are reported commonly in other cancers.
22758774 In primary melanocytic tumours, GNA11 and N-RAS mutations represent a mechanism of MAPK pathway activation alternative to the common GNAQ mutations
22307269 The results expand the spectrum of GNA11 mutations that may occur in melanocytomas.
22240728 The presumed association of TRH-R with G(q/11)alpha proteins in plasma membranes was verified by RNAi experiments
21945171 The DNA obtained is of sufficient quality to carry out genotyping for markers on chromosome 3, 6 and 8, as well as screening for somatic mutations in GNAQ and GNA11 genes.
21464134 Regulation of the epithelial Na+ channel by the RH domain of G protein-coupled receptor kinase, GRK2, and Galphaq/11.
21366456 Benign and malignant blue nevi harbor frequent mutations in the Galphaq class of G-protein alpha subunits, Gnaq and Gna11 proteins.
21083380 Of the uveal melanomas we analyzed, 83% had somatic mutations in GNAQ or GNA11.
21083380 Observational study of gene-disease association. (HuGE Navigator)
20531218 [review] Gq transgene activation mediates cardiac hypertrophy in vivo in response to pressure overload; transgenic mice with cardiac-specific deletion of Galphaq family proteins show no ventricular hypertrophy in response to pressure overload
18713748 Protein kinase C-related kinase and ROCK are required for thrombin-induced endothelial cell permeability downstream from Galpha12/13 and Galpha11/q
18632858 PLC-beta activation and intracellular Ca2+ release are required for HIV-1 gp120-mediated Rac-1 activation and membrane fusion via the G-alpha(q/11) family of G proteins
17552882 Solubilization of this class of Galpha proteins was observed after prolonged agonist stimulation, induced by ultra high concentration of hormone and in cells expressing a large number of GPCRs, revealing tight binding of G(11)alpha protein to the membrane
17535809 two distinct regions of the Cav3.3 channel are necessary and sufficient for complete M1 receptor-mediated channel inhibition
17056873 The phosphorylation of Galpha11 protein represents a novel mechanism involved in regulation of receptor signaling.
16723377 G(q/11)-coupled receptors are the principal G protein-coupled receptor subfamily mediating cooperative mitogenic signaling in airway smooth musscle.
16611642 the ability of MAS to up-regulate AT(1) receptor levels reflects the constitutive capacity of MAS to activate Galpha(q)/Galpha(11) and hence stimulate PKC-dependent phosphorylation of the AT(1) receptor
16365309 CB(1) receptors are stabilized in a conformation that enables G(q)11 signaling by the WIN55212-2 cannabinoid agonist, thus shifting the G protein specificity of the receptor
16350855 soluble amyloid precursor protein release enhancement induced by muscarinic receptor stimulation was decreased by a G(q/11) minigene construct
16297597 These results indicate that the thio-acylation status of the alpha1b-adrenoceptor does not regulate G protein activation whereas thio-acylation of Galpha11 plays a key role in activation by the receptor.
15863506 TPO integrates G(i), but not G(q), stimulation, supports integrin alpha(IIb)beta(3) activation platelet aggregation independently of phospholipase C but requires PI3-kinase and Rap1B
15693018 regulation of the PLC pathway through the PTH1R is significantly increased by elevating expression of G(11)alpha in osteoblastic cells.
15632174 a new signaling pathway by which G alpha(q/11)-coupled receptors specifically induce Rho signaling through a direct interaction of activated G alpha(q/11) subunits with p63RhoGEF.
12759536 GNA11 is involved in signalling of gonadotropin-releasing hormone receptor, which negatively regulates cell growth. Down-regulation is suggested to be involved in human breast cancers.
12130679 the C-terminal domain participates intimately in the efficacy of B1R and B2R G(q/11) coupling by contributing both positive and negative regulatory epitopes.

AA Sequence

MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEE      1 - 70
DKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVSAIKTLWEDPG     71 - 140
IQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQR    141 - 210
SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE    211 - 280
DKILYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ    281 - 350
LNLKEYNLV                                                                 351 - 359
//

Text Mined References (92)

PMID Year Title
26994139 2016 Allosteric Modulation of the Calcium-sensing Receptor Rectifies Signaling Abnormalities Associated with G-protein ?-11 Mutations Causing Hypercalcemic and Hypocalcemic Disorders.
26778290 2016 Mosaic Activating Mutations in GNA11 and GNAQ Are Associated with Phakomatosis Pigmentovascularis and Extensive Dermal Melanocytosis.
26645730 2016 Melanomas Associated With Blue Nevi or Mimicking Cellular Blue Nevi: Clinical, Pathologic, and Molecular Study of 11 Cases Displaying a High Frequency of GNA11 Mutations, BAP1 Expression Loss, and a Predilection for the Scalp.
26462151 2015 Heterogeneity revealed by integrated genomic analysis uncovers a molecular switch in malignant uveal melanoma.
26368812 2015 Distribution of GNAQ and GNA11 Mutation Signatures in Uveal Melanoma Points to a Light Dependent Mutation Mechanism.
26100877 2015 N-linked glycosylation of protease-activated receptor-1 at extracellular loop 2 regulates G-protein signaling bias.
25934394 2015 Identification of Distinct Conformations of the Angiotensin-II Type 1 Receptor Associated with the Gq/11 Protein Pathway and the ?-Arrestin Pathway Using Molecular Dynamics Simulations.
25695059 2015 Low mutational burden of eight genes involved in the MAPK/ERK, PI3K/AKT, and GNAQ/11 pathways in female genital tract primary melanomas.
25304237 2014 GNAQ and GNA11 mutations in uveal melanoma.
25280020 2014 Oncogenic GNAQ and GNA11 mutations in uveal melanoma in Chinese.
24970262 2014 Chromosome 3 status combined with BAP1 and EIF1AX mutation profiles are associated with metastasis in uveal melanoma.
24823460 2014 Autosomal dominant hypoparathyroidism caused by germline mutation in GNA11: phenotypic and molecular characterization.
24576953 2014 Optogenetic activation of Gq signalling modulates pacemaker activity of cardiomyocytes.
24497640 2014 Heparan sulfates mediate the interaction between platelet endothelial cell adhesion molecule-1 (PECAM-1) and the G?q/11 subunits of heterotrimeric G proteins.
24308950 2014 Reduced trabecular bone mass and strength in mice overexpressing G?11 protein in cells of the osteoblast lineage.
24141786 2014 Combined PKC and MEK inhibition in uveal melanoma with GNAQ and GNA11 mutations.
24141704 2013 A bacterial toxin catalyzing tyrosine glycosylation of Rho and deamidation of Gq and Gi proteins.
23802749 2013 Cloning and characterization of the GNA11 promoter and its regulation by early growth response 1.
23802536 2013 Germline mutations affecting G?11 in hypoparathyroidism.
23802516 2013 Mutations affecting G-protein subunit ?11 in hypercalcemia and hypocalcemia.
23782177 2013 A rude awakening--the perioperative sleep apnea epidemic.
23778528 2013 Patient survival in uveal melanoma is not affected by oncogenic mutations in GNAQ and GNA11.
23634288 2013 Ultradeep sequencing detects GNAQ and GNA11 mutations in cell-free DNA from plasma of patients with uveal melanoma.
23599145 2013 Identification of HRAS mutations and absence of GNAQ or GNA11 mutations in deep penetrating nevi.
23572068 2013 Mutational analysis of GNAQ and GNA11 to aid therapy management of a choroidal melanoma metastatic to the contralateral orbit.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22977135 2012 High throughput mass spectrometry-based mutation profiling of primary uveal melanoma.
22758774 2013 GNA11 and N-RAS mutations: alternatives for MAPK pathway activating GNAQ mutations in primary melanocytic tumours of the central nervous system.
22307269 2012 GNAQ and GNA11 mutations in melanocytomas of the central nervous system.
22240728 2012 Identification of a preassembled TRH receptor-G(q/11) protein complex in HEK293 cells.
21945171 2011 Molecular genetic testing of uveal melanoma from routinely processed and stained cytology specimens.
21725197 2011 Neurotensin receptor-1 inducible palmitoylation is required for efficient receptor-mediated mitogenic-signaling within structured membrane microdomains.
21464134 2011 Regulation of the epithelial Na+ channel by the RH domain of G protein-coupled receptor kinase, GRK2, and Galphaq/11.
21366456 2011 Blue nevi and variants: an update.
21269460 2011 Initial characterization of the human central proteome.
21083380 2010 Mutations in GNA11 in uveal melanoma.
21044946 2011 Site-specific analysis of protein S-acylation by resin-assisted capture.
20531218 2010 Cardiac hypertrophy and heart failure development through Gq and CaM kinase II signaling.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18936096 2008 Assembly of high order G alpha q-effector complexes with RGS proteins.
18713748 2008 Protein kinase C-related kinase and ROCK are required for thrombin-induced endothelial cell permeability downstream from Galpha12/13 and Galpha11/q.
18703424 2008 RGS22, a novel testis-specific regulator of G-protein signaling involved in human and mouse spermiogenesis along with GNA12/13 subunits.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17897319 2007 Integral and associated lysosomal membrane proteins.
17552882 2008 The time-course of agonist-induced solubilization of trimeric G(q)alpha/G(11)alpha proteins resolved by two-dimensional electrophoresis.
17535809 2007 Selective inhibition of Cav3.3 T-type calcium channels by Galphaq/11-coupled muscarinic acetylcholine receptors.
17056873 2007 Phosphorylation of Galpha11 protein contributes to agonist-induced desensitization of 5-HT2A receptor signaling.
16723377 2006 Cooperative mitogenic signaling by G protein-coupled receptors and growth factors is dependent on G(q/11).
16611642 2006 Up-regulation of the angiotensin II type 1 receptor by the MAS proto-oncogene is due to constitutive activation of Gq/G11 by MAS.
16365309 2005 The cannabinoid agonist WIN55,212-2 increases intracellular calcium via CB1 receptor coupling to Gq/11 G proteins.
16350855 2005 Direct involvement of G protein alpha(q/11) subunit in regulation of muscarinic receptor-mediated sAPPalpha release.
16297597 2006 Functional interactions between the alpha1b-adrenoceptor and Galpha11 are compromised by de-palmitoylation of the G protein but not of the receptor.
16102047 2005 Protease-activated receptors in hemostasis, thrombosis and vascular biology.
15863506 2005 Thrombopoietin complements G(i)- but not G(q)-dependent pathways for integrin {alpha}(IIb){beta}(3) activation and platelet aggregation.
15693018 2005 Increased expression of G11alpha in osteoblastic cells enhances parathyroid hormone activation of phospholipase C and AP-1 regulation of matrix metalloproteinase-13 mRNA.
15632174 2005 The guanine nucleotide exchange factor p63RhoGEF, a specific link between Gq/11-coupled receptor signaling and RhoA.
15623527 2005 Apical localization of a functional TRPC3/TRPC6-Ca2+-signaling complex in polarized epithelial cells. Role in apical Ca2+ influx.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15322542 2004 Effects of G-protein mutations on skin color.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12759536 2003 Reduced expression of GNA11 and silencing of MCT1 in human breast cancers.
12670961 2003 Heterotrimeric G alpha q/G alpha 11 proteins function upstream of vascular endothelial growth factor (VEGF) receptor-2 (KDR) phosphorylation in vascular permeability factor/VEGF signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12401211 2002 Tandem genomic arrangement of a G protein (Gna15) and G protein-coupled receptor (s1p(4)/lp(C1)/Edg6) gene.
12130679 2002 Negative and positive regulatory epitopes in the C-terminal domains of the human B1 and B2 bradykinin receptor subtypes determine receptor coupling efficacy to G(q/11)-mediated [correction of G(9/11)-mediated] phospholipase Cbeta activity.
11916537 Multiplicity of mechanisms of serotonin receptor signal transduction.
11524429 2001 Stabilization of cortical actin induces internalization of transient receptor potential 3 (Trp3)-associated caveolar Ca2+ signaling complex and loss of Ca2+ influx without disruption of Trp3-inositol trisphosphate receptor association.
11507095 2001 The angiotensin II AT2 receptor is an AT1 receptor antagonist.
11118617 2000 Cloning and characterization of the human phosphoinositide-specific phospholipase C-beta 1 (PLC beta 1).
10789830 2000 Functional coupling of G proteins to endothelin receptors is ligand and receptor subtype specific.
10718832 2000 Calcium-sensing receptor expression and signalling in human parathyroid adenomas and primary hyperplasia.
10598579 1999 Dual signaling of human Mel1a melatonin receptors via G(i2), G(i3), and G(q/11) proteins.
10446129 1999 The prostacyclin receptor is isoprenylated. Isoprenylation is required for efficient receptor-effector coupling.
9858594 1999 RGS3 inhibits G protein-mediated signaling via translocation to the membrane and binding to Galpha11.
9481484 1998 Evidence for the involvement of several intracellular domains in the coupling of oxytocin receptor to G alpha(q/11).
9462300 1997 Activation of the prostaglandin FP receptor in human granulosa cells.
9175863 1997 Interaction of the G-protein G11alpha with receptors and phosphoinositidase C: the contribution of G-protein palmitoylation and membrane association.
9152406 1997 The human thromboxane A2 receptor alpha isoform (TP alpha) functionally couples to the G proteins Gq and G11 in vivo and is activated by the isoprostane 8-epi prostaglandin F2 alpha.
8836152 1996 Specificity of G alpha q and G alpha 11 gene expression in platelets and erythrocytes. Expressions of cellular differentiation and species differences.
8621713 1996 Ras involvement in signal transduction by the serotonin 5-HT2B receptor.
8552586 1996 The human thyrotropin receptor: a heptahelical receptor capable of stimulating members of all four G protein families.
8530500 1995 Interaction between G proteins and tyrosine kinases upon T cell receptor.CD3-mediated signaling.
8317484 1993 Genetic linkage analysis in familial benign (hypocalciuric) hypercalcemia: evidence for locus heterogeneity.
7937899 1994 Mechanism of GTP hydrolysis by G-protein alpha subunits.
7797501 1995 G alpha 15 and G alpha 16 couple a wide variety of receptors to phospholipase C.
7492305 1995 Ca2+ signalling in K562 human erythroleukaemia cells: effect of dimethyl sulphoxide and role of G-proteins in thrombin- and thromboxane A2-activated pathways.
1902575 1991 Guanine nucleotide-binding regulatory proteins in retinal pigment epithelial cells.
1322796 1992 Phospholipase C-beta 1 is a GTPase-activating protein for Gq/11, its physiologic regulator.
1302014 1992 Evolution of the mammalian G protein alpha subunit multigene family.