Property Summary

NCBI Gene PubMed Count 18
PubMed Score 295.06
PubTator Score 66.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Leukemia, Myelocytic, Acute 120
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2499 3.123 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
aldosterone-producing adenoma -1.098 6.1e-03
gastric cancer 1.200 9.1e-03
hepatocellular carcinoma 1.100 1.3e-04
osteosarcoma -1.249 7.5e-04
ovarian cancer -1.100 4.8e-04
subependymal giant cell astrocytoma -1.712 2.9e-02

Gene RIF (6)

AA Sequence

MALCNGDSKLENAGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFR      1 - 70
AIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLF     71 - 140
RGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDI    141 - 210
AGCSGTFTVQNRELECIREIKERVGTSKVLVLLSGGVDSTVCTALLNRALNQEQVIAVHIDNGFMRKRES    211 - 280
QSVEEALKKLGIQVKVINAAHSFYNGTTTLPISDEDRTPRKRISKTLNMTTSPEEKRKIIGDTFVKIANE    281 - 350
VIGEMNLKPEEVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPLKDFHKDEVR    351 - 420
ILGRELGLPEELVSRHPFPGPGLAIRVICAEEPYICKDFPETNNILKIVADFSASVKKPHTLLQRVKACT    421 - 490
TEEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDWESLIFLARLIPRMCHNVNRV    491 - 560
VYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHNILRESGYAGKISQMPVILTPLHFDRDPLQKQPS    561 - 630
CQRSVVIRTFITSDFMTGIPATPGNEIPVEVVLKMVTEIKKIPGISRIMYDLTSKPPGTTEWE           631 - 693
//

Text Mined References (29)

PMID Year Title