Property Summary

NCBI Gene PubMed Count 24
PubMed Score 14.25
PubTator Score 17.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer 1.300 1.1e-03
malignant mesothelioma -1.700 2.3e-07
osteosarcoma -2.578 2.7e-03
posterior fossa group B ependymoma 4.000 5.4e-14
medulloblastoma, large-cell -1.600 3.9e-04
Duchenne muscular dystrophy -1.272 9.2e-09
lung cancer 2.600 4.7e-06
active Crohn's disease 1.710 2.0e-03
atypical teratoid/rhabdoid tumor -1.100 2.9e-02
group 4 medulloblastoma -1.600 3.9e-02
pancreatic carcinoma 1.300 1.1e-03
Endometriosis -1.448 2.9e-02
Pick disease 1.600 2.0e-02
Breast cancer -1.100 1.0e-03
acute myeloid leukemia -2.000 1.3e-03

Synonym

Accession P36959 Q96HQ6 GMPR 1
Symbols GMPR1
GMPR 1

Gene

PANTHER Protein Class (2)

PDB

2BLE   2BWG  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (3)

PMID Text
24139804 GMPR as a suppressor of melanoma invasion is downregulated at the early invasive stages of melanoma progression and whose activity inhibits melanoma cell invasion by depleting intracellular GTP pools.
20864672 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19936222 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQH      1 - 70
SMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVE     71 - 140
FVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAH    141 - 210
GLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAG    211 - 280
GVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS         281 - 345
//

Text Mined References (25)

PMID Year Title
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24139804 2013 A purine nucleotide biosynthesis enzyme guanosine monophosphate reductase is a suppressor of melanoma invasion.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
22780124 2013 Genome-wide association study of a quantitative disordered gambling trait.
22331829 2012 Genetic determinants of statin-induced low-density lipoprotein cholesterol reduction: the Justification for the Use of Statins in Prevention: an Intervention Trial Evaluating Rosuvastatin (JUPITER) trial.
21269460 2011 Initial characterization of the human central proteome.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12009299 2002 NADPH-dependent GMP reductase isoenzyme of human (GMPR2). Expression, purification, and kinetic properties.
9813009 1998 The guanosine monophosphate reductase gene is conserved in rats and its expression increases rapidly in brown adipose tissue during cold exposure.
8750194 1995 An integrated map of human chromosome 6p23.
8188226 1994 Mapping of the human guanosine monophosphate reductase gene (GMPR) to chromosome 6p23 by fluorescence in situ hybridization.
2758468 1989 Two structural genes on different chromosomes are required for encoding the major subunit of human red cell glucose-6-phosphate dehydrogenase.
2570640 1989 The human mRNA that provides the N-terminus of chimeric G6PD encodes GMP reductase.
2364435 1990 Human red cell glucose-6-phosphate dehydrogenase: all active enzyme has sequence predicted by the X chromosome-encoded cDNA.
2194676 1990 Human red cell glucose-6-phosphate dehydrogenase is encoded only on the X chromosome.
1757097 1991 Identification of common variant alleles of the human guanosine monophosphate reductase gene.
1694726 1990 Origin of "fused" glucose-6-phosphate dehydrogenase.
1661705 1991 Genomic structure and expression of human guanosine monophosphate reductase.
218932 1979 Reaction mechanism and specificity of human GMP reductase. Substrates, inhibitors, activators, and inactivators.