Property Summary

NCBI Gene PubMed Count 84
PubMed Score 180.74
PubTator Score 38.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

 GWAS Trait (1)

Gene RIF (60)

AA Sequence

MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVP      1 - 70
ESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKE     71 - 140
LAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI     141 - 209
//

Text Mined References (91)

PMID Year Title