Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.66
PubTator Score 8.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 1.300 5.5e-03
osteosarcoma -2.684 1.0e-08
group 3 medulloblastoma 2.200 1.0e-06
atypical teratoid / rhabdoid tumor 1.100 9.3e-06
medulloblastoma, large-cell 1.100 1.4e-04
primitive neuroectodermal tumor 1.100 6.9e-04
acute myeloid leukemia 1.200 3.9e-02
ovarian cancer 1.700 1.9e-05

Gene RIF (5)

PMID Text
18455874 GMEB1 effectively attenuated caspase activation and apoptosis caused by these stresses in human neuroblastoma SK-N-MC cells, indicating that it functions as a potent inhibitor of caspase activation and apoptosis in response to oxidative stress.
16497673 GMEB1 is an endogenous regulator that selectively binds to initiator procaspases and inhibits caspase-induced apoptosis
15555560 GMEB1 is capable of binding to the prodomain of caspase-2; findings indicated that GMEB1 might be an endogenous inhibitory protein that selectively interacts with prodomain of caspase-2 to disrupt the autoactivation
12702733 1.55 A resolution crystal structure of a central portion of GMEB1, encompassing its SAND domain
11743720 consensus DNA recognition motif for two KDWK transcription factors identifies flexible-length, CpG-methylation sensitive cognate binding sites in the majority of human promoters

AA Sequence

MANAEVSVPVGDVVVVPTEGNEGENPEDTKTQVILQLQPVQQGLFIDGHFYNRIYEAGSENNTAVVAVET      1 - 70
HTIHKIEEGIDTGTIEANEDMEIAYPITCGESKAILLWKKFVCPGINVKCVKFNDQLISPKHFVHLAGKS     71 - 140
TLKDWKRAIRLGGIMLRKMMDSGQIDFYQHDKVCSNTCRSTKFDLLISSARAPVPGQQTSVVQTPTSADG    141 - 210
SITQIAISEESMEEAGLEWNSALTAAVTMATEEGVKKDSEEISEDTLMFWKGIADVGLMEEVVCNIQKEI    211 - 280
EELLRGVQQRLIQAPFQVTDAAVLNNVAHTFGLMDTVKKVLDNRRNQVEQGEEQFLYTLTDLERQLEEQK    281 - 350
KQGQDHRLKSQTVQNVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMG    351 - 420
NIPVATLSQGSSPVTVHTLPSGPQLFRYATVVSSAKSSSPDTVTIHPSSSLALLSSTAMQDGSTLGNMTT    421 - 490
MVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQ    491 - 560
HQVHNVEIVVLED                                                             561 - 573
//

Text Mined References (21)

PMID Year Title
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18455874 2008 GMEB1, a novel endogenous caspase inhibitor, prevents hypoxia- and oxidative stress-induced neuronal apoptosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16497673 2006 Glucocorticoid modulatory element-binding protein 1 binds to initiator procaspases and inhibits ischemia-induced apoptosis and neuronal injury.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15555560 2004 Regulation of procaspase-2 by glucocorticoid modulatory element-binding protein 1 through the interaction with caspase recruitment domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12702733 2003 Crystal structure and nuclear magnetic resonance analyses of the SAND domain from glucocorticoid modulatory element binding protein-1 reveals deoxyribonucleic acid and zinc binding regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11927605 2002 Muscle-specific RING finger-1 interacts with titin to regulate sarcomeric M-line and thick filament structure and may have nuclear functions via its interaction with glucocorticoid modulatory element binding protein-1.
11812797 2002 Ubc9 is a novel modulator of the induction properties of glucocorticoid receptors.
11743720 2001 A consensus DNA recognition motif for two KDWK transcription factors identifies flexible-length, CpG-methylation sensitive cognate binding sites in the majority of human promoters.
10894151 2000 Properties of the glucocorticoid modulatory element binding proteins GMEB-1 and -2: potential new modifiers of glucocorticoid receptor transactivation and members of the family of KDWK proteins.
10734202 2000 Genomic organization of human GMEB-1 and rat GMEB-2: structural conservation of two multifunctional proteins.
10692587 2000 Cloning of a mouse glucocorticoid modulatory element binding protein, a new member of the KDWK family.
10523663 1999 Two new members of the emerging KDWK family of combinatorial transcription modulators bind as a heterodimer to flexibly spaced PuCGPy half-sites.
10386584 1999 Cloning and characterization of hGMEB1, a novel glucocorticoid modulatory element binding protein.