Property Summary

NCBI Gene PubMed Count 24
PubMed Score 105.05
PubTator Score 13.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Multiple myeloma 1.491 8.7e-04
astrocytic glioma -1.400 2.9e-02
psoriasis 1.400 1.0e-03
tuberculosis 1.900 1.7e-08
non-small cell lung cancer 1.084 9.3e-10
intraductal papillary-mucinous adenoma (... 2.300 1.3e-03
intraductal papillary-mucinous carcinoma... 3.000 6.0e-04
intraductal papillary-mucinous neoplasm ... 1.200 4.5e-02
lung cancer 1.400 9.4e-03
active Crohn's disease 1.167 7.8e-03
ulcerative colitis 1.100 1.5e-03
group 3 medulloblastoma 1.100 1.7e-03
nasopharyngeal carcinoma -1.500 9.8e-05
lung adenocarcinoma 1.205 7.6e-04
lung carcinoma 1.600 1.2e-18
spina bifida -1.018 4.2e-02
ductal carcinoma in situ 1.100 1.6e-02
ovarian cancer 1.500 3.9e-04

Synonym

Accession O60547 E9PI88 O75357 Q5T954 Q6FH09 Q9UGZ3 Q9UJK9
Symbols GMD
SDR3E1

Gene

PANTHER Protein Class (2)

PDB

1T2A   5IN4   5IN5  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (11)

PMID Text
26382291 Disruptions of enhancers near FOXC1 and GMDS may influence brain development.
25173105 Data indicate three loci associated with primary open-angle glaucoma (POAG) were located upstream of ATP binding cassette transporter 1 (ABCA1), within actin filament associated protein 1 (AFAP1) and within GDP-mannose 46-dehydratase (GMDS).
23922970 These data demonstrate involvement of GMDS mutation in the progression of colorectal cancer.
23730929 Fx enzyme and GDP-L-Fuc Tr overexpression in the tumur tissue of colorectal cancer (CRC) patients suggests that GDP-L-Fuc transport to the Golgi apparatus may be an important factor associated with increased alpha(1,6)fucosylation in CRC.
22645305 GMD inhibits tankyrase 1 poly(ADP-ribose) polymerase activity in vitro, dependent on the GMD tankyrase 1 binding motif. In vivo, depletion of GMD led to degradation of tankyrase 1, dependent on the catalytic PARP activity of tankyrase 1.
22027835 Results indicate that GMDS regulates the formation of secondary complex II from the primary DISC independent of direct fucosylation of death receptors.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of GDP-mannose 4,6-dehydratase (GMDS) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19361506 Deficiency of GMDS leads to escape from natural killer cell-mediated tumor surveillance through modulation of TRAIL signaling.
11831876 FX takes part in the cascade of events leading to the extravasation of activated lymphocytes.

AA Sequence

MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYK      1 - 70
NPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGVGTLRLLDAVK     71 - 140
TCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHE    141 - 210
SPRRGANFVTRKISRSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHS    211 - 280
VREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVA    281 - 350
FDELVREMVHADVELMRTNPNA                                                    351 - 372
//

Text Mined References (27)

PMID Year Title
26382291 2016 Disruptions in a cluster of computationally identified enhancers near FOXC1 and GMDS may influence brain development.
25416956 2014 A proteome-scale map of the human interactome network.
25173105 2014 Common variants near ABCA1, AFAP1 and GMDS confer risk of primary open-angle glaucoma.
23922970 2013 Mutation of GDP-mannose-4,6-dehydratase in colorectal cancer metastasis.
23730929 2013 FX enzyme and GDP-L-Fuc transporter expression in colorectal cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22645305 2012 GDP-mannose-4,6-dehydratase is a cytosolic partner of tankyrase 1 that inhibits its poly(ADP-ribose) polymerase activity.
22027835 2011 GDP-mannose-4,6-dehydratase (GMDS) deficiency renders colon cancer cells resistant to tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor- and CD95-mediated apoptosis by inhibiting complex II formation.
22020760 2012 Polymorphic markers associated with severe oxaliplatin-induced, chronic peripheral neuropathy in colon cancer patients.
21502949 2011 Discovery and replication of dopamine-related gene effects on caudate volume in young and elderly populations (N=1198) using genome-wide search.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19361506 2009 Deficiency of GMDS leads to escape from NK cell-mediated tumor surveillance through modulation of TRAIL signaling.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698403 2002 Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism.
9603974 1998 Molecular cloning and expression of GDP-D-mannose-4,6-dehydratase, a key enzyme for fucose metabolism defective in Lec13 cells.
9525924 1998 Molecular cloning of human GDP-mannose 4,6-dehydratase and reconstitution of GDP-fucose biosynthesis in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.