Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.51
PubTator Score 5.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung cancer 2890 1.2e-15
osteosarcoma 7950 5.7e-05
lung cancer 4740 8.9e-04
group 3 medulloblastoma 4104 1.8e-02
aldosterone-producing adenoma 665 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Aggressive systemic mastocytosis 20 4.014 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
aldosterone-producing adenoma -1.159 2.5e-02
group 3 medulloblastoma 1.200 1.8e-02
lung cancer 1.800 8.9e-04
non-small cell lung cancer 1.153 1.2e-15
osteosarcoma 1.629 5.7e-05

Synonym

Accession Q96IK5 Q9H826 Q9H8V7 Q9H927
Symbols GCL
GCL1
BTBD13
SPATA29

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MGSLSSRVLRQPRPALAQQAQGARAGGSARRPDTGDDAAGHGFCYCAGSHKRKRSSGSFCYCHPDSETDE      1 - 70
DEEEGDEQQRLLNTPRRKKLKSTSKYIYQTLFLNGENSDIKICALGEEWSLHKIYLCQSGYFSSMFSGSW     71 - 140
KESSMNIIELEIPDQNIDVEALQVAFGSLYRDDVLIKPSRVVAILAAACLLQLDGLIQQCGETMKETVNV    141 - 210
KTVCGYYTSAGTYGLDSVKKKCLEWLLNNLMTHQNVELFKELSINVMKQLIGSSNLFVMQVEMDIYTALK    211 - 280
KWMFLQLVPSWNGSLKQLLTETDVWFSKQRKDFEGMAFLETEQGKPFVSVFRHLRLQYIISDLASARIIE    281 - 350
QDAVVPSEWLSSVYKQQWFAMLRAEQDSEVGPQEINKEELEGNSMRCGRKLAKDGEYCWRWTGFNFGFDL    351 - 420
LVTYTNRYIIFKRNTLNQPCSGSVSLQPRRSIAFRLRLASFDSSGKLICSRTTGYQILTLEKDQEQVVMN    421 - 490
LDSRLLIFPLYICCNFLYISPEKKN                                                 491 - 515
//

Text Mined References (14)

PMID Year Title