Property Summary

NCBI Gene PubMed Count 14
PubMed Score 20.37
PubTator Score 7.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
D-glycericacidemia 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 9.1e-07
pancreatic ductal adenocarcinoma liver metastasis 1962 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count
D-Glyceric aciduria 1

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.466 9.1e-07
pancreatic ductal adenocarcinoma liver m... -1.142 4.7e-02

Gene RIF (3)

AA Sequence

MAAALQVLPRLARAPLHPLLWRGSVARLASSMALAEQARQLFESAVGAVLPGPMLHRALSLDPGGRQLKV      1 - 70
RDRNFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKGIRAAMERAGKQEMLLKPHSRVQVFE     71 - 140
GAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQ    141 - 210
ELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYGLRAAL    211 - 280
PRSVKTVLSRADSDPHGPHTCGHVLNVIIGSNVLALAEAQRQAEALGYQAVVLSAAMQGDVKSMAQFYGL    281 - 350
LAHVARTRLTPSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRG    351 - 420
GRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDIATFLAHNDSH    421 - 490
TFFCCLQGGAHLLHTGMTGTNVMDTHLLFLRPR                                         491 - 523
//

Text Mined References (18)

PMID Year Title