Property Summary

NCBI Gene PubMed Count 5
PubMed Score 154.41
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.200 1.2e-02
ductal carcinoma in situ 1.900 3.3e-03
invasive ductal carcinoma 2.200 4.8e-02
ovarian cancer -1.800 2.9e-08
pancreatic ductal adenocarcinoma liver m... -2.195 4.3e-03

AA Sequence

MILLNNSHKLLALYKSLARSIPESLKVYGSVYHINHGNPFNMEVLVDSWPEYQMVIIRPQKQEMTDDMDS      1 - 70
YTNVYRMFSKEPQKSEEVLKNCEIVNWKQRLQIQGLQESLGEGIRVATFSKSVKVEHSRALLLVTEDILK     71 - 140
LNASSKSKLGSWAETGHPDDEFESETPNFKYAQLDVSYSGLVNDNWKRGKNERSLHYIKRCIEDLPAACM    141 - 210
LGPEGVPVSWVTMDPSCEVGMAYSMEKYRRTGNMARVMVRYMKYLRQKNIPFYISVLEENEDSRRFVGQF    211 - 280
GFFEASCEWHQWTCYPQNLVPF                                                    281 - 302
//

Text Mined References (7)

PMID Year Title